玩彩平台

  • <tr id='K5PR4J'><strong id='K5PR4J'></strong><small id='K5PR4J'></small><button id='K5PR4J'></button><li id='K5PR4J'><noscript id='K5PR4J'><big id='K5PR4J'></big><dt id='K5PR4J'></dt></noscript></li></tr><ol id='K5PR4J'><option id='K5PR4J'><table id='K5PR4J'><blockquote id='K5PR4J'><tbody id='K5PR4J'></tbody></blockquote></table></option></ol><u id='K5PR4J'></u><kbd id='K5PR4J'><kbd id='K5PR4J'></kbd></kbd>

    <code id='K5PR4J'><strong id='K5PR4J'></strong></code>

    <fieldset id='K5PR4J'></fieldset>
          <span id='K5PR4J'></span>

              <ins id='K5PR4J'></ins>
              <acronym id='K5PR4J'><em id='K5PR4J'></em><td id='K5PR4J'><div id='K5PR4J'></div></td></acronym><address id='K5PR4J'><big id='K5PR4J'><big id='K5PR4J'></big><legend id='K5PR4J'></legend></big></address>

              <i id='K5PR4J'><div id='K5PR4J'><ins id='K5PR4J'></ins></div></i>
              <i id='K5PR4J'></i>
            1. <dl id='K5PR4J'></dl>
              1. <blockquote id='K5PR4J'><q id='K5PR4J'><noscript id='K5PR4J'></noscript><dt id='K5PR4J'></dt></q></blockquote><noframes id='K5PR4J'><i id='K5PR4J'></i>

                Ladenchrome

                chrome17  时间:2021-02-05  阅读:()
                VerwendungvonVMwareViewHorizonClientfürWindowsJanuar2014HorizonViewDiesesDokumentunterstütztdieaufgeführtenProduktversionensowieallefolgendenVersionen,bisdasDokumentdurcheineneueAuflageersetztwird.
                DieneuestenVersionendiesesDoku-mentsfindenSieunterhttp://www.
                vmware.
                com/de/support/pubs.
                DE-001179-02VerwendungvonVMwareViewHorizonClientfürWindows2VMware,Inc.
                DieneuestetechnischeDokumentationfindenSieaufderVMware-Websiteunter:http://www.
                vmware.
                com/de/support/AufderVMware-WebsitefindenSieauchdieaktuellenProdukt-Updates.
                FallsSieAnmerkungenzudieserDokumentationhaben,sendenSieIhreKommentareundVorschlgean:docfeedback@vmware.
                comCopyright2014VMware,Inc.
                AlleRechtevorbehalten.
                InformationenzuCopyrightundMarken.
                VMware,Inc.
                3401HillviewAve.
                PaloAlto,CA94304www.
                vmware.
                comVMwareGlobal,Inc.
                ZweigniederlassungDeutschlandFreisingerStr.
                385716Unterschleiheim/LohhofGermanyTel.
                :+49(0)89370617000Fax:+49(0)89370617333www.
                vmware.
                com/deInhaltVerwendungvonVMwareHorizonViewClientfürWindows51SystemanforderungenundSetupvonWindows-basiertenViewClients7SystemanforderungenfürWindows-Clients8SystemanforderungenfürEchtzeit-Audio/Video9VoraussetzungenfürdieVerwendungderMultimedia-Umleitung(MMR)10AnforderungenzurVerwendungderFlash-URL-Umleitung11VoraussetzungenfürdieVerwendungvonMicrosoftLyncmitHorizonViewClient12AnforderungenfürdieSmartcard-Authentifizierung13ClientbrowseranforderungenfürViewPortal14UnterstützteDesktop-Betriebssysteme15VorbereitendesView-VerbindungsserversfürHorizonViewClient15DurchVMwaregesammelteHorizonViewClient-Daten162InstallationvonViewClientfürWindows19InstallierenvonViewClientfürWindows19KonfigurierenderimViewPortalangezeigtenViewClient-Download-Links21UnbeaufsichtigteInstallationvonViewClient233KonfigurierenvonHorizonViewClientfürEndbenutzer29VerwendenvonURIszurKonfigurationvonHorizonViewClient30KonfigurierenderZertifikatsprüfungenfürEndbenutzer34KonfigurierenvonVMwareHorizonViewClientfürWindowsmithilfederGruppenrichtlinien-vorlage37AusführenvonViewClientausderBefehlszeile49KonfigurierendesHorizonViewClientmithilfederWindows-Registrierung524VerwaltungderSerververbindungenundDesktops55AnmeldunganeinemView-Desktop55WechselnzwischenDesktops58AbmeldenoderTrennenvonDesktops585ArbeitenaufeinemView-Desktop61Funktionsunterstützungs-Matrix61Internationalisierung62VerwendungmehrererMonitore62VerbindenvonUSB-Gerten63VerwendenderEchtzeit-Audio/Video-FunktionfürWebcamsundMikrofone66KopierenundEinfügenvonTextundBildern69DruckenvoneinemRemote-Desktopaus70SteuernderAnzeigevonAdobeFlash71VMware,Inc.
                3VerwendenderFunktionderrelativenMausbewegungfürCAD-und3D-Anwendungen726FehlerbehebungfürHorizonViewClient73Vorgehensweise,wennViewClientunerwartetbeendetwird73ZurücksetzeneinesDesktops73DeinstallierenvonHorizonViewClient74Index75VerwendungvonVMwareViewHorizonClientfürWindows4VMware,Inc.
                VerwendungvonVMwareHorizonViewClientfürWindowsDiesesHandbuch,VerwendungvonVMwareHorizonViewClientfürWindows,bietetInformationenüberdieInstallationundVerwendungderVMwareHorizonView-SoftwareaufeinemMicrosoftWindows-ClientsystemzurVerbindungsherstellungmiteinemView-DesktopimRechenzentrum.
                DieInformationenindiesemDokumentumfassenSystemanforderungenundAnweisungenzurInstallationundVerwendungvonHorizonViewClientfürWindows.
                DieseInformationensindfürAdministratorenbestimmt,dieeineBereitstellungvonHorizonViewmitMic-rosoftWindows-Clientsystemenermglichenmüssen,soz.
                B.
                DesktopsundLaptops.
                DieInformationenwurdenfürerfahreneSystemadministratorenverfasst,diemitderTechnologievirtuellerMaschinensowiemitVorgngeninRechenzentrenvertrautsind.
                VMware,Inc.
                5VerwendungvonVMwareViewHorizonClientfürWindows6VMware,Inc.
                SystemanforderungenundSetupvonWindows-basiertenViewClients1Systeme,aufdenenViewClient-Komponentenausgeführtwerden,müssenbestimmteHardware-undSoft-wareanforderungenerfüllen.
                SystememitViewClientaufWindowsverwendenbeiderVerbindungsherstellungmitdemView-Verbin-dungsserverMicrosoftInternetExplorer-Einstellungen,z.
                B.
                Proxyeinstellungen.
                StellenSiesicher,dassIhreInternetExplorer-EinstellungenrichtigsindundSieüberInternetExploreraufdieURLfürdenView-Ver-bindungsserverzugreifenknnen.
                DiesesKapitelbehandeltdiefolgendenThemen:nSystemanforderungenfürWindows-Clients",aufSeite8nSystemanforderungenfürEchtzeit-Audio/Video",aufSeite9nVoraussetzungenfürdieVerwendungderMultimedia-Umleitung(MMR)",aufSeite10nAnforderungenzurVerwendungderFlash-URL-Umleitung",aufSeite11nVoraussetzungenfürdieVerwendungvonMicrosoftLyncmitHorizonViewClient",aufSeite12nAnforderungenfürdieSmartcard-Authentifizierung",aufSeite13nClientbrowseranforderungenfürViewPortal",aufSeite14nUnterstützteDesktop-Betriebssysteme",aufSeite15nVorbereitendesView-VerbindungsserversfürHorizonViewClient",aufSeite15nDurchVMwaregesammelteHorizonViewClient-Daten",aufSeite16VMware,Inc.
                7SystemanforderungenfürWindows-ClientsHorizonViewClientfürWindowskannaufPCsoderLaptopsinstalliertwerden,dieeinMicrosoftWind-ows8.
                x-,Windows7-,Vista-oderXP-Betriebssystemverwenden.
                SowohldiePCsoderLaptops,aufdenenSieHorizonViewClientinstallieren,alsauchdieverwendetenPe-ripheriegertemüssenbestimmteSystemanforderungenerfüllen.
                ModellStandardmigesx86-Systemoderx86-Systemmit64-Bit-KompatibilittfürDesktop-oderLaptopcomputerArbeitsspeicherMindestens1GBArbeitsspeicher(RAM)BetriebssystemeBetriebssystemVersionSPWindows8oder8.
                132oder64Bit–Windows732oder64BitOhneoderSP1WindowsXP32BitSP3WindowsVista32BitSP1oderSP2FürWindows7undWindowsVistawerdendiefolgendenEditionenunter-stützt:Home,Enterprise,Professional/BusinessundUltimate.
                FürWindowsXPwerdendieEditionenHomeundProfessionalunterstützt.
                FürWindows8und8.
                1werdendiefolgendenEditionenunterstützt:Wind-ows8oder8.
                1Pro-DesktopundWindows8oder8.
                1Enterprise–Desktop.
                View-Verbindungsser-ver,SicherheitsserverundViewAgentAktuelleWartungsversionvonVMwareView4.
                6.
                xundsptereVersionenWennClientsystemevonauerhalbderfirmeneigenenFirewalleineVerbin-dungherstellen,empfiehltVMwaredieVerwendungeinesSicherheitsser-vers.
                MiteinemSicherheitsservererforderndieClientsystemekeineVPN-Verbindung.
                AnzeigeprotokollfürHorizonViewPCoIPoderRDPHardwareanforderungenfürPCoIPnx86-basierterProzessormitSSE2-Erweiterungen,miteinerProzessorge-schwindigkeitvon800MHzoderhher.
                nVerfügbarerRAMüberdenSystemanforderungenzurUnterstützungverschiedenerMonitorkonfigurationen.
                ImAllgemeinengiltdiefolgen-deFormel:20MB+(24*(AnzahlderMonitore)*(BreitedesMonitors)*(HhedesMonitors))AlsgrobesMaknnenSiediefolgendenBerechnungenverwenden:1Monitor:1600x1200:64MB2Monitore:1600x1200:128MB3Monitore:1600x1200:256MBHardwareanforderungenfürRDPnx86-basierterProzessormitSSE2-Erweiterungen,miteinerProzessorge-schwindigkeitvon800MHzoderhher.
                VerwendungvonVMwareViewHorizonClientfürWindows8VMware,Inc.
                n128MBRAM.
                SoftwareanforderungenfürRDPnFürWindowsXP-undWindowsXPEmbedded-SystemeistMicrosoftRDP6.
                1zuverwenden.
                nWindowsVistaumfasstRDP6.
                1;eswirdjedochRDP7.
                1empfohlen.
                nFürWindows7istRDP7.
                1oder8.
                0zuverwenden.
                Windows7umfasstRDP7.
                Windows7SP1umfasstRDP7.
                1.
                nFürWindows8istRDP8.
                0zuverwenden.
                FürWindows8.
                1istRDP8.
                1zuverwenden.
                nFürvirtuelleWindowsXP-MaschinenmüssenSiedieRDP-Patchesin-stallieren,dieindenKnowledgebase-Artikeln323497und884020aufge-führtsind.
                WennSiedieRDP-Patchesnichtinstallieren,wirdmglicher-weiseeinWindowsSocket-FehleraufdemClientangezeigt.
                nDasViewAgent-InstallationsprogrammkonfiguriertdielokaleFirewall-RegelfüreingehendeRDP-VerbindungenentsprechenddemaktuellenRDP-PortdesHostbetriebssystems(üblicherweise3389).
                WennSiedieRDP-Portnummerndern,müssenSiediedazugehrigenFirewall-Re-gelnndern.
                DieRDC-VersionenstehenimMicrosoftDownloadCenterzumDownloadzurVerfügung.
                SystemanforderungenfürEchtzeit-Audio/VideoEchtzeit-Audio/VideoarbeitetmitStandardwebcams,USB-Audio-undanalogenAudiogertenundkannmitstandardmigenKonferenzanwendungenwiez.
                B.
                Skype,WebExundGoogleHangoutsverwendetwerden.
                ZurUnterstützungvonEchtzeit-Audio/VideomussIhreHorizonView-BereitstellungbestimmteSoftware-undHardwareanforderungenerfüllen.
                HorizonView-Remote-DesktopAufdenDesktopsmussViewAgent5.
                2oderspterinstalliertsein.
                AufdenDesktopsmussauerdemdieentsprechendeVersionvonRemoteExperienceAgentinstalliertsein.
                WennViewAgent5.
                3installiertist,müssenSieauchRemoteExperienceAgentausdemHorizonView5.
                3FeaturePack1instal-lieren.
                WeitereInformationenfindenSieimDokumentInstallationundVer‐waltungvonVMwareHorizonViewFeaturePackfürVMwareHorizonView-HorizonViewClient-SoftwareHorizonViewClient2.
                2fürWindowsoderhherHorizonViewClient-ComputeroderClientzu-griffsgertnEchtzeit-Audio/VideowirdaufallenBetriebssystemenunterstützt,aufdenenHorizonViewClientfürWindowsausgeführtwird.
                WeitereIn-formationenfindenSieunterSystemanforderungenfürWindows-Clients",aufSeite8.
                nAufdemClientcomputermüssenTreiberfürWebcamundAudiogerteinstalliertsein,unddieWebcamoderdasAudiogertmussbetriebsbe-reitsein.
                ZurUnterstützungvonEchtzeit-Audio/Videoistesnichterfor-derlich,dieGertetreiberaufdemDesktop-Betriebssystemzuinstallie-ren,aufdemViewAgentinstalliertist.
                AnzeigeprotokollfürHorizonViewPCoIPEchtzeit-Audio/VideowirdinRDP-Desktop-Sitzungennichtunterstützt.
                Kapitel1SystemanforderungenundSetupvonWindows-basiertenViewClientsVMware,Inc.
                9VoraussetzungenfürdieVerwendungderMultimedia-Umleitung(MMR)DieMultimedia-Umleitung(MMR)stelltdenMultimedia-StreamdirektaufdenClientcomputernbereit.
                MitMMRwirdderMultimediadatenstromaufdemClientsystemverarbeitet,d.
                h.
                entschlüsselt.
                DasClient-systemgibtdieMedieninhaltewiederundlagertsodieAnforderungvomESXi-Hostaus.
                DaMMRaufdenverschiedenenBetriebssystemenunterschiedlichimplementiertwird,unterscheidensichdieSystemanforderungenfürWindows7vondenenfürWindowsVistaundfrüherenBetriebssystemen.
                WICHTIGWindows8View-DesktopsunterstützenMMRnicht.
                VerwendenSiefürdieseView-AgentendieWindows-Medienumleitung,dieimLieferumfangvonRDP7undspterenthaltenist.
                MMR-UnterstützungundAnforderungenfürWindows7IhreServer,virtuellenDesktopsundClientcomputermüssenbestimmteSystemanforderungenerfüllen,umMMRaufView-DesktopsmitWindows7undaufClientsmitWindows7oderWindows8verwendenzuknnen.
                VMware-Softwareanfor-derungennAufdenHorizonView-Servernund-DesktopsmussVMwareHorizonView-5.
                3odereinesptereVersioninstalliertsein.
                nAufdenvirtuellenDesktopsmüssenSiezudemdenaktuellenRemoteExperienceAgentinstallieren.
                SieheInstallationundVerwaltungvonVMwareHorizonViewFeaturePackfürVMwareHorizonView-5.
                3Fea-turePack1.
                nAufViewClientsmüssenSieVMwareHorizonViewClient2.
                2oderspterfürWindowsinstallieren.
                nInformationenüberandereerforderlicheKonfigurationseinstellungenfindenSieimDokumentInstallationundVerwaltungvonVMwareHorizonViewFeaturePackfürVMwareHorizonView-5.
                3Fea-turePack1.
                HorizonView-DesktopnAufdenDesktopsmusseinWindows7-Betriebssystemmit64Bitoder32Bitausgeführtwerden.
                nFürdenDesktop-Poolmussdas3D-Renderingaktiviertwerden.
                nDievirtuellenDesktop-MaschinenmüssenvirtuelleHardwarederVer-sion8oderhherverwenden.
                nBenutzermüssenVideosmitWindowsMediaPlayer12oderhherab-spielen.
                ViewClient-ComputeroderClientzugriffsgertnAufdenClientsmusseinWindows7-oderWindows8-Betriebssystemmit64Bitoder32Bitausgeführtwerden.
                nDieClientsmüssenüberDVXA-kompatible(DirectXVideoAccelerati-on)Grafikkartenverfügen,diedieausgewhltenVideosdecodierenknnen.
                VerwendungvonVMwareViewHorizonClientfürWindows10VMware,Inc.
                nAufdenClientsmussWindowsMediaPlayer12oderhherinstalliertsein,umeineUmleitungzurlokalenHardwarezuunterstützen.
                UnterstützteMedienfor-mateDieMedienformatemüssendemH.
                264-StandardzurVideokomprimierungentsprechen.
                DieDateiformateM4V,MP4undMOVwerdenunterstützt.
                Ih-revirtuellenDesktopsmüsseneinesdieserDateiformateverwenden,undaufdenClientsystemenmüssenlokaleDecoderfürdieseFormatevorhandensein.
                MMR-UnterstützungundAnforderungenfürWindowsVistaundWindowsXPIhreServer,virtuellenDesktopsundClientcomputermüssenbestimmteSystemanforderungenerfüllen,umMMRaufView-Desktopsund-ClientsmitWindowsVistaundWindowsXPverwendenzuknnen.
                VMware-Softwareanfor-derungennSiemüssenüberVMwareView-Serverund-DesktopsderVersion4.
                6.
                1oderspterverfügen.
                nAufViewClientsmüssenSieViewClientfürWindows,Version4.
                6.
                1oderspter,installieren.
                HorizonView-DesktopnAufdenDesktopsmussdie32-Bit-VersionvonWindowsVistaoderWindowsXPausgeführtwerden.
                nBenutzermüssenVideosmitWindowsMediaPlayer10oderhherab-spielen.
                ViewClient-ComputeroderClientzugriffsgertnAufdenClientsmussdie32-Bit-VersionvonWindowsVista,Wind-owsXPoderWindowsXPEmbeddedausgeführtwerden.
                nAufdenClientsmussWindowsMediaPlayer10oderhherinstalliertsein,umeineUmleitungzurlokalenHardwarezuunterstützen.
                nDieViewClient-HardwarezurVideoanzeigemussOverlay-Unterstüt-zungbieten,damitMMRordnungsgemfunktioniert.
                UnterstützteMedienfor-mateDieMMR-FunktionunterstütztdieMediendateiformate,diedasClientsys-temunterstützt,daaufdemClientlokaleDecodervorhandenseinmüssen.
                DateiformatesindunteranderemMPEG2-1,MPEG-2,MPEG-4Part2;WMV7,8und9;WMA;AVI;ACE;MP3undWAV.
                HINWEISSiemüssendenMMR-PortinIhrerFirewall-SoftwarealsAusnahmehinzufügen.
                Derstandardm-igePortfürMMRlautet9427.
                AnforderungenzurVerwendungderFlash-URL-UmleitungDurchdasdirekteStreamingvonFlash-InhaltenvonAdobeMediaServeraufClientendpunktewirddieDa-tenlastaufdemESXi-HostimRechenzentrumgesenkt,daszustzlicheRoutingüberdasRechenzentrumvermiedenunddieerforderlicheBandbreitezumsimultanenStreamingvonLive-Video-EreignissenanmehrereClientendpunkteverringert.
                DieFlash-URL-UmleitungverwendeteinJavaScript,dasdurchdenWebseitenadministratorineineWebsei-teeingebettetwird.
                Immerdann,wenneinBenutzereinesvirtuellenDesktopsauseinerWebseiteaufdenfestgelegtenURL-Linkklickt,fngtdasJavaScriptdieShockWave-Datei(SWF)vondervirtuellenDesktop-SitzungabundleitetsieandenClientendpunktum.
                DerEndpunktkannanschlieendauerhalbdervirtu-ellenDesktop-SitzungeinenlokalenVMwareFlashProjectorffnenunddenMedienstreamlokalabspielen.
                Kapitel1SystemanforderungenundSetupvonWindows-basiertenViewClientsVMware,Inc.
                11DieseFunktionistverfügbar,wennsiezusammenmitderrichtigenVersiondesVMwareHorizonView-FeaturePacksverwendetwird.
                nAnforderungenfürMulticast-Unterstützung:VMwareHorizonView-5.
                2FeaturePack2oderspter.
                nAnforderungenfürUnicast-Unterstützung:VMwareHorizonView-5.
                3FeaturePack1oderspter.
                UmdieseFunktionzuverwenden,müssenSieIhreWebseiteundIhreClientgerteeinrichten.
                DieClient-systememüssenbestimmteSoftwareanforderungenerfüllen:nFüreineMulticast-UnterstützungmüssenSiedieClientsystemeHorizonViewClient5.
                4oder2.
                2oderspterverwenden.
                FüreineUnicast-UnterstützungmüssenSiedieClientsystemeHorizonViewClient2.
                2oderspterverwenden.
                nClientsystememüssenüberIP-KonnektivittmitdemAdobeWebserververfügen,aufdemdieShock-Wave-Datei(SWF)zurInitiierungdesMulticast-oderUnicast-Streaminggehostetwird.
                Fallserforder-lich,müssenSieinIhrerFirewalldiegeeignetenPortsffnen,umClientgertendenZugriffaufdiesenServerzuermglichen.
                nClientsystememüssenüberAdobeFlashPlayer10.
                1oderhherfürInternetExplorerverfügen(dieserverwendetActiveX).
                EineListederView-Desktop-AnforderungenfürdieFlash-URL-UmleitungsowieAnweisungenzumKonfi-guriereneinerWebseitezurBereitstellungdesMulticast-oderUnicast-StreamingfindenSieimDokumentInstallationundVerwaltungvonVMwareHorizonViewFeaturePack.
                VoraussetzungenfürdieVerwendungvonMicrosoftLyncmitHorizonViewClientSieknneneinenMicrosoftLync2013-ClientaufView-Desktopseinsetzen,umanUnifiedCommunications(UC)VoIP(VoiceoverIP)undVideo-ChatsmitLync-zertifiziertenUSB-Audio-und-Videogertenteilzu-nehmen.
                EinspeziellesIP-Telefonistnichtlngererforderlich.
                FürdieseneueArchitekturistdieInstallationeinesMicrosoftLync2013-ClientsaufdemView-DesktopundvoneinemMicrosoftLyncVDI-Plug-InaufdemClientendpunkterforderlich.
                KundenknnendenMicro-softLync2013-ClientfürPrsenz,InstantMessaging,WebkonferenzundMicrosoftOffice-Funktionenver-wenden.
                SobaldeinLyncVoIP-AnrufoderVideo-Chateintrifft,nimmtdasLync-VDI-Plug-IndiegesamteMedien-verarbeitungvomRechenzentrumsserveraufdenClientendpunktundcodiertalleMedieninLync-opti-miertenAudio-undVideocodecs.
                DieseoptimierteArchitekturistuerstskalierbar,waszueinergeringe-renNutzungderNetzwerkbandbreiteführtundUnterstützungfürqualitativhochwertigeVoIP-undVi-deo-bertragungvonPunktzuPunktinEchtzeitbietet.
                WeitereInformationenfindenSieimBlogeintragEnd-UserComputingBlog"unterhttp://blogs.
                vmware.
                com/euc/2013/06/the-abcs-of-deploying-vmware-horizon-view-5-2-with-microsoft-lync-2013.
                html.
                HINWEISDieAufnahmevonAudiowirdnochnichtunterstützt.
                DieseIntegrationwirdnurmitdemPCoIP-Anzeigeprotokollunterstützt.
                FürdieseFunktiongeltendiefolgendenAnforderungen.
                BetriebssystemnClient-Betriebssystem:32-Bit-oder64-Bit-SystemmitWindows7SP1oderWindows8VerwendungvonVMwareViewHorizonClientfürWindows12VMware,Inc.
                nBetriebssystemdervirtuellenMaschine(Agent):32-oder64-Bit-Wind-ows7SP1SoftwaredesClientsys-temsnHorizonViewClientfürWindows5.
                3oderspterfürWindows7-Clientsysteme,HorizonViewClient5.
                4oderspterfürWindows8-ClientsystemeoderHorizonViewClientfürWindows2.
                2oderspter.
                n32-Bit-VersiondesMicrosoftLyncVDI-Plug-InsWICHTIGDie64-Bit-VersionvonMicrosoftOfficemussnichtaufdemClientcomputerinstalliertwerden.
                Daserforderliche32-Bit-MicrosoftLyncVDI-Plug-Inistnichtmitder64-Bit-VersionvonMicrosoftOffice2013kompatibel.
                nDasSicherheitszertifikat,daswhrendderBereitstellungvonMicrosoftLyncServer2013erzeugtwird,mussindasVerzeichnisdervertrauens-würdigenStammzertifizierungsstellenimportiertwerden.
                SoftwarefürdenView-Desktop(Agent)nHorizonViewAgent5.
                2oderspternMicrosoftLync2013-ClientDieBit-VersiondesLync2013-ClientssolltederBit-VersiondesBetriebs-systemsdervirtuellenMaschineentsprechen,wennSieeinenHorizonView5.
                2-Agentenverwenden.
                WennSiedenHorizonView5.
                3-Agentenverwenden,mussdieBit-VersiondesLync2013-ClientsnichtmitderBit-VersiondesBetriebssystemsdervirtuellenMaschineüber-einstimmen.
                nDasSicherheitszertifikat,daswhrendderBereitstellungvonMicrosoftLyncServer2013erzeugtwird,mussindasVerzeichnisdervertrauens-würdigenStammzertifizierungsstellenimportiertwerdenErforderlicheServernEinServer,aufdemView-Verbindungsserver5.
                2oderspterausgeführtwirdnEinServer,aufdemMicrosoftLyncServer2013ausgeführtwirdnEinevSphere-InfrastrukturzurAufnahmedervirtuellenMaschinenAufdemvCenterServerunddenESXi-HostsmussvSphere5.
                0oderh-herausgeführtwerden.
                HardwarenHardware,dieallederzuvorgenanntenerforderlichenSoftwarekompo-nentenunterstütztnClientendpunkt:1,5GHzoderschnellereCPUundmindestens2GBRAMfürdasMicrosoftLync2013-Plug-InAnforderungenfürdieSmartcard-AuthentifizierungClientsysteme,dieeineSmartcardfürdieBenutzerauthentifizierungverwenden,müssenbestimmteAnfor-derungenerfüllen.
                FürjedesClientsystem,daszurBenutzerauthentifizierungeineSmartcardverwendet,geltendiefolgendenSoftware-undHardwareanforderungen:nHorizonViewClientnEinWindows-kompatiblerSmartcard-LeserKapitel1SystemanforderungenundSetupvonWindows-basiertenViewClientsVMware,Inc.
                13nSmartcard-MiddlewarenProduktspezifischeAnwendungstreiberSiemüssenaufdenRemote-DesktopszustzlichproduktspezifischeAnwendungstreiberinstallieren.
                HorizonViewunterstütztSmartcardsundSmartcard-Leser,dieeinenPKCS#11-oderMicrosoftCryptoAPI-Anbieterverwenden.
                OptionalknnenSiedasActivClient-SoftwarepaketvonActivIdentityinstallieren,dasToolszurInteraktionmitSmartcardsbereitstellt.
                Benutzer,diesichmithilfevonSmartcardsauthentifizieren,müssenübereinSmartcard-oderUSB-Smart-card-Tokenverfügen,undjedeSmartcardmusseinBenutzerzertifikatenthalten.
                ZumInstallierenvonZertifikatenaufeinerSmartcardmüssenSieeinenComputereinrichten,deralsRegist-rierungsstellefungiert.
                DieserComputermussSmartcard-ZertifikatefürBenutzerausgebenknnenundMitgliedderDomnesein,fürdieSieZertifikateausgeben.
                WICHTIGWennSieeineSmartcardanmelden,knnenSiedieSchlüsselgredesresultierendenZertifikatsauswhlen.
                ZurVerwendungvonSmartcardsauflokalenDesktopsmüssenSiebeiderSmartcard-Registrie-rungeineSchlüsselgrevon1024Bitoder2048Bitauswhlen.
                Zertifikatemit512-Bit-Schlüsselnwerdennichtunterstützt.
                DieMicrosoftTechNet-WebsiteenthltausführlicheInformationenzuPlanungundImplementierungderSmartcard-AuthentifizierungfürWindows-Systeme.
                NebenderEinhaltungdieserAnforderungenfürHorizonViewClient-SystememüssenandereHorizonView-KomponentenbestimmteAnforderungenandieKonfigurationzurUnterstützungvonSmartcardserfüllen:nInformationenzurKonfigurationvonViewServernfürdieNutzungvonSmartcardsfindenSieunterdemThemaKonfigurierenderSmartcard-Authentifizierung"imDokumentVerwaltungvonVMwareHorizonView.
                nInformationenzudenAufgaben,dieSiewomglichinActiveDirectoryzurImplementierungderSmartcard-Authentifizierungdurchführenmüssen,findenSieindenHilfethemenzurVorbereitungvonActiveDirectoryfürdieSmartcard-AuthentifizierungimDokumentInstallationvonVMwareHori‐zonView.
                ClientbrowseranforderungenfürViewPortalVoneinemClientsystemausknnenSieeinenBrowserffnenundzueinerbestimmtenView-Verbindungs-server-Instanznavigieren.
                BeiderangezeigtenWebseitehandeltessichumeinPortal,dasLinkszumHe-runterladenderInstallationsdateivonHorizonViewCliententhlt.
                UmüberdasPortaleinHorizonViewClient-Installationsprogrammherunterzuladen,müssenSieüberei-nenderfolgendenWebbrowserverfügen:nInternetExplorer8nInternetExplorer9nInternetExplorer10(voneinemWindows8-SystemimDesktop-Modus)nFirefox6undhhernSafari5(aufeinemMac)nChrome14oderhherVerwendungvonVMwareViewHorizonClientfürWindows14VMware,Inc.
                WennIhrAdministratorVMwareHorizonViewHTMLAccessaufdemServerinstallierthat,wirdunterUmstndenaucheinSymbolfürdieVerbindungmiteinemvirtuellenDesktopüberdenBrowserangezeigt,ohnedasseineClientsoftwareinstalliertwerdenmuss.
                FürdieseHTML-Zugriff-FunktionsindneuereBrowserversionenerforderlich:nChrome28oderhhernInternetExplorer9oderhhernSafari6oderhhernMobileSafariaufiOS-GertenmitiOS6oderhhernFirefox21oderhherUnterstützteDesktop-BetriebssystemeAdministratorenerstellenvirtuelleMaschinenmiteinemGastbetriebssystemundinstallierenViewAgentaufdiesemGastbetriebssystem.
                DieEndbenutzerknnensichandiesenvirtuellenMaschinenvoneinemClient-Gertausanmelden.
                EineListemitunterstütztenGastbetriebssystemenfindenSieunterdemThemaUnterstützteBetriebssyste-mefürViewAgent"inderDokumentationInstallationvonHorizonView4.
                6.
                xoder5.
                x".
                VorbereitendesView-VerbindungsserversfürHorizonViewClientAdministratorenmüssenbestimmteAufgabendurchführen,umEndbenutzerndieVerbindungzudenRe-mote-Desktopszuermglichen.
                BevorEndbenutzereineVerbindungmitdemView-VerbindungsserverodereinemSicherheitsserverher-stellenundaufeinenRemote-Desktopzugreifenknnen,müssenbestimmtePool-undSicherheitseinstel-lungenkonfiguriertwerden:nWennSieeinenSicherheitsserververwenden,wievonVMwareempfohlen,stellenSiesicher,dassSiedieaktuellenWartungsversionenfüreinenView-VerbindungsserverderVersion4.
                6.
                xundfüreinenView-SicherheitsserverderVersion4.
                6.
                xoderhherverwenden.
                SiehedieDokumentationInstallationvonVMwareHorizonView‐.
                nWennSieeinesichereTunnelverbindungfürClientgerteverwendenmchtenunddiesichereVerbin-dungmiteinemDNS-HostnamenfürdenView-VerbindungsserverodereinenSicherheitsserverkonfi-guriertist,musssichergestelltwerden,dassdasClientgertdiesenDNS-Namenauflsenkann.
                NavigierenSiezurAktivierungoderDeaktivierungdersicherenTunnelverbindunginViewAdminist-ratoraufdasDialogfeldView-Verbindungsserver-EinstellungenbearbeitenundsetzenSieeinenHakenindasKontrollkstchenSichereTunnelverbindungzumDesktopverwenden.
                nVergewissernSiesich,dasseinDesktop-PoolerstelltwurdeunddasBenutzerkonto,dasSieverwendenmchten,überdieRechtezumZugriffaufdiesenRemote-Desktopverfügt.
                SieheHilfethemenzurEr-stellungvonDesktop-PoolsinderDokumentationVerwaltungvonVMwareHorizonView‐.
                nZumVerwendenderzweistufigenAuthentifizierungfürHorizonViewClient,z.
                B.
                derRSASecurID-oderRADIUS-Authentifizierung,müssenSiedieseFunktionaufdemView-Verbindungsserveraktivie-ren.
                DieRADIUS-AuthentifizierungistbeiView-VerbindungsservernmitView5.
                1oderhherverfüg-bar.
                WeitereInformationenfindenSieindenThemenüberzweistufigeAuthentifizierunginderDoku-mentationVerwaltungvonVMwareHorizonView‐.
                Kapitel1SystemanforderungenundSetupvonWindows-basiertenViewClientsVMware,Inc.
                15DurchVMwaregesammelteHorizonViewClient-DatenWennIhrUnternehmenamProgrammzurVerbesserungderBenutzerfreundlichkeitteilnimmt,erhebtVMwareDatenausbestimmtenHorizonViewClient-Feldern.
                FeldermitvertraulichenInformationenwer-denanonymisiert.
                HINWEISDieseFunktionistnurverfügbar,wennIhreHorizonView-BereitstellungdenView-Verbindungs-serverderVersion5.
                1odereinerhherenVersionverwendet.
                Client-InformationenwerdenfürClientsmitViewClient2.
                0undhhergesendet.
                VMwaresammeltdieDatenaufdenClientszurPriorisierungderHardware-undSoftwarekompatibilitt.
                WennsicheinAdministratorIhresUnternehmenszurTeilnahmeamProgrammzurVerbesserungderBe-nutzerfreundlichkeitentscheidet,sammeltVMwareanonymeDatenüberIhreBereitstellung,umdieReakti-onvonVMwareaufdieKundenanforderungenverbessernzuknnen.
                EswerdenjedochkeineDatenge-sammelt,dieAufschlussüberIhrUnternehmengebenknnten.
                DieHorizonViewClient-InformationenwerdenerstandenView-VerbindungsserverunddannanVMwaregesendet,zusammenmitdenDatenderHorizonView-Server,Desktop-PoolsundRemote-Desktops.
                AuchwenndieInformationenbeiderbertragungandenView-Verbindungsserververschlüsseltwerden,werdendieInformationendesClientsystemsunverschlüsseltineinembenutzerspezifischenVerzeichnisprotokolliert.
                DieProtokolleenthaltenjedochkeinepersonen-oderunternehmensbezogenenInformationen.
                ZurTeilnahmeamVMware-ProgrammzurVerbesserungderBenutzerfreundlichkeitkannderAdministra-tor,derdieInstallationdesView-Verbindungsserversdurchführt,beiderAusführungdesInstallations-As-sistentenfürdenView-VerbindungsserverdieseOptionabonnieren"odernachderInstallationeineent-sprechendeOptioninViewAdministratorfestlegen.
                Tabelle11.
                VondenHorizonViewClient-InstanzengesammelteDatenfürdasProgrammzurVerbesserungderBenutzerfreundlichkeitBeschreibungWirddiesesFeldanonymisiertBeispielswertUnternehmen,dasdiedieHorizonViewClient-AnwendungentwickelteNo(Nein)VMwareProduktnameNo(Nein)VMwareHorizonViewClientClient-ProduktversionNo(Nein)DasFormatlautetx.
                x.
                x‐yyyyyy,wobeix.
                x.
                xfürdieClient-VersionsnummerundyyyyyyfürdieBuild-Nummersteht.
                Client-BinrarchitekturNo(Nein)Beispielehierfürsind:ni386nx86_64narmClient-Build-NameNo(Nein)Beispielehierfürsind:nVMware-Horizon-View-Client-Win32-WindowsnVMware-Horizon-View-Client-LinuxnVMware-Horizon-View-Client-iOSnVMware-Horizon-View-Client-MacnVMware-Horizon-View-Client-AndroidnVMware-Horizon-View-Client-WinStoreHost-BetriebssystemNo(Nein)Beispielehierfürsind:nWindows8.
                1nWindows7,ServicePack1für64Bit(Build7601)niPhoneOS5.
                1.
                1(9B206)nUbuntu10.
                04.
                4LTSnMacOSX10.
                7.
                5(11G63)VerwendungvonVMwareViewHorizonClientfürWindows16VMware,Inc.
                Tabelle11.
                VondenHorizonViewClient-InstanzengesammelteDatenfürdasProgrammzurVerbesserungderBenutzerfreundlichkeit(Fortsetzung)BeschreibungWirddiesesFeldanonymisiertBeispielswertHost-BetriebssystemkernelNo(Nein)Beispielehierfürsind:nWindows6.
                1.
                7601SP1nDarwinKernelVersion11.
                0.
                0:SunApr821:52:26PDT2012;root:xnu-1878.
                11.
                10~1/RELEASE_ARM_S5L8945XnDarwin11.
                4.
                2nLinux2.
                6.
                32-44-generic#98-UbuntuSMPMonSep2417:27:10UTC2012nunbekannt(fürWindowsStore)Host-BetriebssystemarchitekturNo(Nein)Beispielehierfürsind:nx86_64ni386narmv71nARMHostsystem-ModellNo(Nein)Beispielehierfürsind:nDellInc.
                OptiPlex960niPad3,3nMacBookPro8,2nDellInc.
                PrecisionWorkStationT3400(A0403/21/2008)Hostsystem-CPUNo(Nein)Beispielehierfürsind:nIntel(R)Core(TM)2DuoCPUE8400@3.
                00GHnIntel(R)Core(TM)2QuadCPUQ6600@2.
                40GHnunbekannt(füriPad)AnzahlderCoresbzw.
                KerneimProzessordesHostsystemsNo(Nein)Beispiel:4MBArbeitsspeicheraufdemHost-systemNo(Nein)Beispielehierfürsind:n4096nunbekannt(fürWindowsStore)Kapitel1SystemanforderungenundSetupvonWindows-basiertenViewClientsVMware,Inc.
                17VerwendungvonVMwareViewHorizonClientfürWindows18VMware,Inc.
                InstallationvonViewClientfürWindows2SieknnendasWindows-basierteViewClient-InstallationsprogrammentwedervonderVMware-WebsiteoderüberViewPortalabrufen,einerSeitefürdenWebzugriff,dievonView-Verbindungsserverbereitge-stelltwird.
                NachderInstallationvonViewClientknnenSieverschiedeneStartoptionenfürdieEndbenut-zerfestlegen.
                DiesesKapitelbehandeltdiefolgendenThemen:nInstallierenvonViewClientfürWindows",aufSeite19nKonfigurierenderimViewPortalangezeigtenViewClient-Download-Links",aufSeite21nUnbeaufsichtigteInstallationvonViewClient",aufSeite23InstallierenvonViewClientfürWindowsEndbenutzerffnenViewClient,umvoneinemClientsystemauseineVerbindungmitihrenvirtuellenDesktopsherzustellen.
                SieknneneineWindows-basierteInstallationsdateizumInstallierensmtlicherKomponentenvonViewClientausführen.
                DieserVorgangbeschreibtdieInstallationvonViewClientübereineninteraktivenInstallationsassistenten.
                WennSiestattdessendieBefehlszeilenoptionbzw.
                dieOptionzurunbeaufsichtigtenInstallationdesMicro-softWindowsInstaller(MSI)verwendenmchten,findenSieweitereInformationenunterUnbeaufsichtig-teInstallationvonViewClient",aufSeite23.
                VoraussetzungennStellenSiesicher,dassdasClientsystemeinunterstütztesBetriebssystemverwendet.
                SieheSysteman-forderungenfürWindows-Clients",aufSeite8.
                nStellenSiesicher,dassSieüberdieURLfüreineDownload-Seiteverfügen,aufdersichdasVMwareHorizonViewClient-Installationsprogrammbefindet.
                BeidieserURLkannessichumdieVMwareDownloads-Seiteunterhttp://www.
                vmware.
                com/go/viewclientsoderumdieURLfüreineView-Verbindungsserver-Instanzhandeln.
                WennSiezueinerView-Verbindungsserver-URLnavigieren,verweisendieLinksaufdieserPortalseitestandardmigaufdieVMwareDownloads-Seite.
                SieknnendieLinkskonfigurieren,sodasssieaufeinenanderenSpeicherortverweisen.
                WeitereInformationenfindenSieunterKonfigurierenderimViewPortalangezeigtenViewClient-Download-Links",aufSeite21.
                JenachKonfigurationdieserSei-tewirdunterUmstndenaucheinLinkfürVMwareHorizonViewHTMLAccessangezeigt.
                HTML-ZugriffermglichtesIhnen,eineVerbindungzueinemvirtuellenDesktopüberdenBrowserherzustellen,ohneClientsoftwareinstallierenzumüssen.
                VMwareHorizonViewClientbietetmehrFunktionenundeinehhereLeistungalsderHTMLAccess-Client,weshalbVMwareimAllgemeinendieInstallationderClientsoftwareempfiehlt.
                nStellenSiesicher,dassSiesichalsAdministratoraufdemClientsystemanmeldenknnen.
                VMware,Inc.
                19nStellenSiesicher,dassViewAgentnichtinstalliertist.
                nVoraussetzungenfürdieUSB-Umleitung:nBestimmenSie,obderBenutzerdesClientgertsvoneinemvirtuellenDesktopauflokalverbunde-neUSB-Gertezugreifendarf.
                IstdiesnichtderFall,knnenSieentwederdievomAssistentenvor-gelegteKomponenteUSB-UmleitungdeaktivierenoderdieKomponenteinstallieren,siejedochunterVerwendungvonGruppenrichtlinienobjektendeaktivieren.
                VMwareempfiehlt,dieKomponenteUSB-UmleitungimmerzuinstallierenundGruppenrichtlini-enobjektezurSteuerungdesUSB-Zugriffszuverwenden.
                AufdieseWeisemüssenSieViewClientnichtnocheinmalneuinstallieren,wennSiedieUSB-UmleitungfüreinenClientzueinemspterenZeitpunktaktivierenmchten.
                WeitereInformationenfindenSieunterdemThemaEinstellungenfürdieADM-VorlagederViewClient-Konfiguration"imKapitelüberdieKonfigurationsrichtlini-enimDokumentVerwaltungvonVMwareHorizonView.
                nWennSiedieKomponenteUSB-Umleitunginstallierenmchten,stellenSiesicher,dassdieFunk-tionfürautomatischeWindows-UpdatesaufdemClientcomputernichtdeaktiviertwurde.
                nBestimmenSie,obdieFunktionverwendetwerdensoll,mitderEndbenutzersichbeiViewClientundihremvirtuellenDesktopalsaktuellangemeldeterBenutzeranmeldenknnen.
                DieAnmeldeinformati-onendesBenutzers,diedieserzurAnmeldungamClientsystemeingegebenhat,werdenandieView-Verbindungsserver-InstanzundschlielichandenvirtuellenDesktopübergeben.
                EinigeClientbetriebs-systemebietenkeineUnterstützungfürdieseFunktion.
                nWennSienichtmchten,dassdieEndbenutzerdenvollqualifiziertenDomnennamen(FQDN)derView-Verbindungsserverinstanzeingebenmüssen,ermittelnSiedenFQDN,umihnwhrendderIn-stallationangebenzuknnen.
                Vorgehensweise1MeldenSiesichalsBenutzermitAdministratorberechtigungenamClientsysteman.
                2NavigierenSieaufdemClientsystemzuderURLzumHerunterladenderInstallationsdatei.
                WhlenSiedieentsprechendeInstallationsdateiaus,wobeixxxxxxdieBuild-Nummerundy.
                y.
                ydieVersionsnummerist.
                OptionAktionViewClientauf64-Bit-Betriebssys-temenWhlenSieVMware-Horizon-View-Client-x86_64-y.
                y.
                y-xxxxxx.
                exe,wobeiy.
                y.
                yfürdieVersionsnummerundxxxxxxfürdieBuildnummersteht.
                ViewClientauf32-Bit-Betriebssys-temenWhlenSieVMware-Horizon-View-Client-x86-y.
                y.
                y-xxxxxx.
                exe,wobeiy.
                y.
                yfürdieVersionsnummerundxxxxxxfürdieBuildnummersteht.
                3ZumStartendesViewClient-InstallationsprogrammsdoppelklickenSieaufdieInstallationsdatei.
                4FolgenSiedenAnweisungenzumInstallierendergewünschtenKomponenten.
                DerVMwareViewClient-DienstwirdaufdemWindows-Clientcomputerinstalliert.
                DerProzessnamefürViewClientlautetvmware-view.
                DieDienstefürdieUSB-KomponentenlautenVMwa-reUSBArbitration-Dienst(VMUSBArbService)undVMwareViewUSB(vmware-view-usbd).
                WeiterStartenSieViewClientundstellenSiesicher,dassSiesichamrichtigenvirtuellenDesktopanmeldenkn-nen.
                SieheAnmeldunganeinemView-Desktop",aufSeite55.
                VerwendungvonVMwareViewHorizonClientfürWindows20VMware,Inc.
                KonfigurierenderimViewPortalangezeigtenViewClient-Download-LinksStandardmigenthltdiePortalseite,dieangezeigtwird,wennSieeinenBrowserffnenunddieURLei-nerView-Verbindungsserverinstanzeingeben,LinkszurVMware-Download-Site,umHorizonViewClientherunterzuladen.
                DieStandardknnengendertwerden.
                DieStandardlinksfürHorizonViewClientaufderPortalseitesorgendafür,dassSiezudenderzeitkompa-tiblenHorizonViewClient-Installationsprogrammenumgeleitetwerden.
                IneinigenFllensollendieLinksjedochaufeineninternenWebserververweisenoderSiemchtenbestimmteClientversionenaufIhremei-genenView-VerbindungsserverzurVerfügungstellen.
                SieknnendieSeiteneukonfigurieren,sodasssieaufeineandereURLverweist.
                WennSieLinksfürMacOSX-,Linux-undWindows-Clientsystemeerstellen,wirdderentsprechendeLinkzumjeweiligenBetriebssystemaufderPortalseiteangezeigt.
                WennSiebeispielsweisediePortalseiteaufei-nemWindows-Systemffnen,werdendieLinksfürdieWindows-Installationsprogrammeangezeigt.
                SieknnenauchseparateLinksfürdie32-Bit-und64-Bit-Installationsprogrammeerstellen.
                SieknnenauchLinksfüriOS-undAndroid-Systemeerstellen.
                DieseBetriebssystemewerdenjedochnichtautomatischer-kannt,sodassSiebeispielsweisebeimffnenderPortalseiteaufeinemiPaddieLinksfüriOSundAndroidsehen,sofernSieLinksfürdiebeidenerstellthaben.
                WICHTIGWennSiediePortalseiten-Linksanpassen,wieindiesemThemabeschrieben,undspterVMwareHorizonViewHTMLAccessaufdemServerinstallieren,wirdIhrebenutzerdefiniertePortalseitedurcheineHTML-Zugriff-Seiteersetzt.
                InformationenzumAnpassendieserSeitefindenSieunterVerwen‐dungvonVMwareHorizonViewHTMLAccess.
                VoraussetzungennLadenSiedieInstallationsdateienfürdieHorizonViewClient-Typenherunter,dieSieinIhrerUmge-bungeinsetzenmchten.
                DieURLfürdieClient-Download-Seiteisthttps://www.
                vmwa-re.
                com/go/viewclients.
                nLegenSiefest,aufwelchemHTTP-ServerdieInstallationsdateienliegensollen.
                DieDateienknnensichaufeinerView-Verbindungsserver-InstanzoderaufeinemanderenHTTP-Serverbefinden.
                Vorgehensweise1ErstellenSieaufdemHTTP-Server,aufdemsichdieInstallationsdateienbefindensollen,einenOrdnerfürdieDateiendesInstallationsprogramms.
                UmdieDateienbeispielsweiseineinenOrdnerdownloadsimStandardinstallationsverzeichnisaufdemView-Verbindungsserver-Hostzustellen,verwendenSiedenfolgendenPfad:C:\Programme\VMware\VMwareView\Server\broker\webapps\downloadsDieLinkszudenDateienwürdendannURLsmitdemFormathttps://Servername/downloads/Client-Installer-Dateinameverwenden.
                EinServermitdemNamenview.
                mycompany.
                comkanndiefolgendeURLfürViewClientfürWindowsverwenden:https://view.
                mycompany.
                com/downloads/VMware-Hori-zon-View-Client.
                exe.
                BeidiesemBeispielbefindetsichderOrdnermitdemNamendownloadsimStammordnerwebapps.
                2KopierenSiedieInstallationsdateienindenOrdner.
                WennsichderOrdneraufeinemView-Verbindungsserver-Dienstneubefindet,knnenSiealleDateienindiesemOrdnerersetzen,ohnedenVMwareView-Verbindungsserver-Dienstneustartenzumüssen.
                3KopierenSieaufdemView-VerbindungsserverdieDateiportal-links.
                propertiesunddieDateipor-tal.
                properties,diesichunterInstallationspfad\Server\Extras\PortalExamplesbefinden.
                Kapitel2InstallationvonViewClientfürWindowsVMware,Inc.
                214LegenSieeinenOrdnerportalimVerzeichnisC:\ProgramData\VMware\VDMan,undkopierenSiedieDa-teienportal-links.
                propertiesundportal.
                propertiesindenOrdnerportal.
                5BearbeitenSiedieDateiC:\ProgramData\VMware\VDM\portal\portal-links.
                propertiesso,dasssieaufdenneuenSpeicherortderInstallationsdateienverweist.
                SieknnendieZeilenindieserDateibearbeitenundihnenweiterehinzufügen,fallsSieweitereLinkserstellenmüssen.
                SieknnenauchZeilenlschen.
                DiefolgendenBeispielezeigenEigenschaftenzumErstellenvonzweiLinksfürViewClientfürWind-owssowiezweiLinksfürViewClientfürLinux:link.
                win=https://server-name/downloads/VMware-Horizon-View-Client-x86_64-y.
                y.
                y-XXXX.
                exe#winlink.
                win.
                1=https://server-name/downloads/VMware-Horizon-View-Client-y.
                y.
                y-XXXX.
                exe#winlink.
                linux=https://server-name/downloads/VMware-Horizon-View-Client-x86_64-y.
                y.
                y-XXXX.
                rpm#linuxlink.
                linux.
                1=https://server-name/downloads/VMware-Horizon-View-Client-y.
                y.
                y-XXXX.
                tar.
                gz#linuxBeidiesemBeispielgibty.
                y.
                y-XXXXdieVersions-undBuild-Nummeran.
                DerTextwinamEndederZeileweistdaraufhin,dassdieserLinkimBrowserangezeigtwerdensoll,wennderClientübereinWindows-Betriebssystemverfügt.
                VerwendenSiewinfürWindows,linuxfürLinuxundmacfürMacOSX.
                VerwendenSiefürandereBetriebssystemeunknown.
                6BearbeitenSiefürTextdieDateiC:\ProgramData\VMware\VDM\portal\portal.
                propertiesso,dasssiedenanzuzeigendenTextfürdieLinksangibt.
                DieseZeilenstehenimAbschnittderDateinamens#keysbasedonkeynamesinportal-links.
                pro-pertieszurVerfügung.
                DasfolgendeBeispielzeigtdenText,derdenfürlink.
                winundlink.
                win.
                1angegebenenLinksent-spricht:text.
                win=ViewClientforWindows32bitClientuserstext.
                win.
                1=ViewClientforWindows64bitClientusers7StartenSiedenVMwareView-Verbindungsserver-Dienstneu.
                WennEndbenutzerdenView-Verbindungsserverffnen,sehensieLinksmitdemvonIhnenangegebenenText.
                DieLinksverweisenaufdievonIhnenangegebenStellen.
                VerwendungvonVMwareViewHorizonClientfürWindows22VMware,Inc.
                UnbeaufsichtigteInstallationvonViewClientSieknneneineunbeaufsichtigteInstallationvonViewClientdurchführen,indemSiedenNamenderIn-stallationsdateisowiediegewünschtenInstallationsoptionenanderBefehlszeileeingeben.
                Dieunbeaufsich-tigteInstallationermglichteineeffizienteBereitstellungvonView-KomponentenineinemgroenUnter-nehmen.
                UnbeaufsichtigteInstallationvonViewClientSieknnendieMSI-Funktion(MicrosoftWindowsInstaller)fürdieunbeaufsichtigteInstallationverwen-den,umdenViewClientaufmehrerenWindows-Computernzuinstallieren.
                BeieinerunbeaufsichtigtenIn-stallationverwendenSiedieBefehlszeileundmüssennichtaufEingabeaufforderungendesAssistentenrea-gieren.
                VoraussetzungennStellenSiesicher,dassdasClientsystemeinunterstütztesBetriebssystemverwendet.
                SieheSysteman-forderungenfürWindows-Clients",aufSeite8.
                nStellenSiesicher,dassSiesichalsAdministratoraufdemClientsystemanmeldenknnen.
                nStellenSiesicher,dassViewAgentnichtinstalliertist.
                nBestimmenSie,obdieFunktionverwendetwerdensoll,mitderEndbenutzersichbeiViewClientundihremvirtuellenDesktopalsaktuellangemeldeterBenutzeranmeldenknnen.
                DieAnmeldeinformati-onendesBenutzers,diedieserzurAnmeldungamClientsystemeingegebenhat,werdenandieView-Verbindungsserver-InstanzundschlielichandenvirtuellenDesktopübergeben.
                EinigeClientbetriebs-systemebietenkeineUnterstützungfürdieseFunktion.
                nMachenSiesichmitdenMSI-Befehlszeilenoptionenvertraut.
                SieheBefehlszeilenoptionenfürMicro-softWindowsInstaller",aufSeite25.
                nMachenSiesichmitdenverfügbarenMSI-EigenschaftenfürdieunbeaufsichtigteInstallationvonViewClientvertraut.
                SieheEigenschaftenfürdieunbeaufsichtigteInstallationvonViewClient",aufSei-te24.
                nLegenSiefest,obSieEndbenutzernvonihrenvirtuellenDesktopsausdenZugriffauflokalangeschlos-seneUSB-Gertegestattenmchten.
                Fallsnicht,legenSieüberdieMSI-EigenschaftADDLOCALdieListederrelevantenFunktionenfestundlassenSiedieUSB-Funktionaus.
                WeitereInformationenfindenSieunterEigenschaftenfürdieunbeaufsichtigteInstallationvonViewClient",aufSeite24.
                nWennSienichtmchten,dassdieEndbenutzerdenvollqualifiziertenDomnennamen(FQDN)derView-Verbindungsserverinstanzeingebenmüssen,ermittelnSiedenFQDN,umihnwhrendderIn-stallationangebenzuknnen.
                Kapitel2InstallationvonViewClientfürWindowsVMware,Inc.
                23Vorgehensweise1LadenSieaufdemClientsystemdieViewClient-InstallationsdateivonderVMware-Produktseiteunterhttp://www.
                vmware.
                com/go/viewclientsherunter.
                WhlenSiedieentsprechendeInstallationsdateiaus,wobeixxxxxxdieBuild-Nummerundy.
                y.
                ydieVersionsnummerist.
                OptionAktionViewClientauf64-Bit-Betriebssys-temenWhlenSieVMware-Horizon-View-Client-x86_64-y.
                y.
                y-xxxxxx.
                exe,wobeiy.
                y.
                yfürdieVersionsnummerundxxxxxxfürdieBuildnummersteht.
                ViewClientauf32-Bit-Betriebssys-temenWhlenSieVMware-Horizon-View-Client-x86-y.
                y.
                y-xxxxxx.
                exe,wobeiy.
                y.
                yfürdieVersionsnummerundxxxxxxfürdieBuildnummersteht.
                2ffnenSieaufdemWindows-ClientcomputereineEingabeaufforderung.
                3GebenSiedenInstallationsbefehlineinerZeileein.
                IndiesemBeispielwirdeineunbeaufsichtigteInstallationvonViewClientdurchgeführt:VMware-Hori-zon-View-Client-x86-y.
                y.
                y-xxxxxx.
                exe/s/v"/qnADDLOCAL=Core"HINWEISDieFunktionCoreistverbindlich.
                WeiterStartenSieViewClientundstellenSiesicher,dassSiesichamrichtigenvirtuellenDesktopanmeldenkn-nen.
                SieheAnmeldunganeinemView-Desktop",aufSeite55.
                EigenschaftenfürdieunbeaufsichtigteInstallationvonViewClientSieknnenspezifischeEigenschafteneinschlieen,wennSieeineunbeaufsichtigteInstallationvonViewClientüberdieBefehlszeiledurchführen.
                SiemüssendasFormatEIGENSCHAFT=Wertverwenden,damitMic-rosoftWindowsInstaller(MSI)dieEigenschaftenundWerteinterpretierenkann.
                ImAbschnittTabelle2-1werdendieEigenschaftenfürdieunbeaufsichtigteInstallationvonViewClientge-zeigt,dieSieanderBefehlszeileverwendenknnen.
                Tabelle21.
                MSI-EigenschaftenfürdieunbeaufsichtigteInstallationvonViewClientMSI-EigenschaftBeschreibungStandardwertINSTALLDIRPfadundVerzeichnisfürdieInstallationderViewClient-Soft-ware.
                Beispiel:INSTALLDIR=""D:\abc\meinOrdner""DiePaaredoppelterAnführungszeichen,diedenPfadum-schlieen,ermglichenesdemMSIInstaller,dasLeerzeichenalsgültigenTeildesPfadeszuinterpretieren.
                DieseMSI-Eigenschaftistoptional.
                %ProgramFiles%\VMwa-re\VMwareHorizonViewClientVDM_SERVERDervollqualifizierteDomnennamen(FQDN)derView-Ver-bindungsserverinstanz,mitdersichViewClient-Benutzerstandardmigverbinden.
                WennSiedieseEigenschaftkonfi-gurieren,müssenViewClient-BenutzerdiesenFQDNnichtangeben.
                Beispiel:VDM_SERVER=cs1.
                companydomain.
                comDieseMSI-Eigenschaftistoptional.
                KeineVerwendungvonVMwareViewHorizonClientfürWindows24VMware,Inc.
                Tabelle21.
                MSI-EigenschaftenfürdieunbeaufsichtigteInstallationvonViewClient(Fortsetzung)MSI-EigenschaftBeschreibungStandardwertDESKTOP_SHORTCUTKonfigurierteinDesktop-VerknüpfungssymbolfürViewCli-ent.
                BeiVerwendungdesWerts1wirddieVerknüpfunginstal-liert.
                BeiVerwendungdesWerts0wirddieVerknüpfungnichtinstalliert.
                DieseMSI-Eigenschaftistoptional.
                1STARTMENU_SHORTCUTKonfigurierteineVerknüpfungfürViewClientimStartmenü.
                BeiVerwendungdesWerts1wirddieVerknüpfunginstal-liert.
                BeiVerwendungdesWerts0wirddieVerknüpfungnichtinstalliert.
                DieseMSI-Eigenschaftistoptional.
                1IneinemBefehlfürdieunbeaufsichtigteInstallationknnenSiedieMSI-EigenschaftADDLOCAL=zumFestle-genvonFunktionenverwenden,diedasViewClient-Installationsprogrammkonfiguriert.
                JedeFunktionei-nerunbeaufsichtigtenInstallationentsprichteinerSetupoption,dieSiewhrendeinerinteraktivenInstallati-onauswhlenknnen.
                ImAbschnittTabelle2-2werdendieViewClient-Funktionengezeigt,dieSieanderBefehlszeileeingebenknnen.
                EswerdenauerdemdiezugehrigenOptionenbeieinerinteraktivenInstallationaufgeführt.
                Tabelle22.
                ViewClient-FunktionenfürdieunbeaufsichtigteInstallationundbenutzerdefinierteSetupoptionenfürdieinteraktiveInstallationFunktionfürdieunbeaufsichtigteInstallationBenutzerdefinierteSetupoptionineinerinteraktivenIn-stallationCoreWennSiemitderMSI-EigenschaftADDLOCAL=einzelneFunktionenangeben,müssenSieCoreeinschlieen.
                Keine.
                WhrendeinerinteraktivenInstallationwerdendieViewClient-Core-Funktionenstandardmiginstalliert.
                ThinPrintVirtuellesDruckenTSSOMeldenSiesichalsderzeitangemeldeterWindows-Dom-nenbenutzeran.
                USBUSB-UmleitungBefehlszeilenoptionenfürMicrosoftWindowsInstallerZurunbeaufsichtigtenInstallationvonView-KomponentenmüssenSiedieBefehlszeilenoptionenundEi-genschaftenvonMicrosoftWindowsInstaller(MSI)verwenden.
                DieInstallationsprogrammefürView-KomponentensindMSI-ProgrammeundverwendenstandardmigeMSI-Funktionen.
                SieknnenauchMSI-BefehlszeilenoptionenzumunbeaufsichtigtenDeinstallierenvonView-Komponentenverwenden.
                EinzelheitenzuMSIfindenSieaufderWebsitevonMicrosoft.
                InformationenzuMSI-BefehlszeilenoptionenfindenSieaufderWebsitederMSDN-Bibliothek(MicrosoftDeveloperNetwork),wennSienachMSI-Be-fehlszeilenoptionensuchen.
                InformationenzurVerwendungderMSI-BefehlszeileerhaltenSie,indemSieaufdemComputermitderView-KomponenteeineEingabeaufforderungffnenundmsiexec/eingeben.
                FürdieunbeaufsichtigteInstallationeinerView-KomponentedeaktivierenSiezunchstdasBootstrap-Pro-gramm,mitdemdasInstallationsprogrammineintemporresVerzeichnisextrahiertundeineinteraktiveInstallationgestartetwird.
                Tabelle2-3zeigtdieBefehlszeilenoptionen,diedasBootstrap-ProgrammdesInstallationsprogrammssteu-ern.
                Kapitel2InstallationvonViewClientfürWindowsVMware,Inc.
                25Tabelle23.
                BefehlszeilenoptionenfürdasBootstrap-ProgrammeinerView-KomponenteOptionBeschreibung/sDeaktiviertdenBootstrap-Splash-BildschirmunddasDialogfeldfürdieExtrak-tion,wodurchdieAnzeigeinteraktiverDialogfelderunterbundenwird.
                Beispiel:VMware-viewconnectionserver-y.
                y.
                y-xxxxxx.
                exe/sDieOption/sisterforderlich,umeineunbeaufsichtigteInstallationdurchzu-führen.
                IndenBeispielenstehtxxxxxxfürdieBuild-Nummerundy.
                y.
                yfürdieVersionsnummer.
                /v"MSI-Befehlszeilenoptionen"WeistdenInstalleran,dieindoppeltenAnführungszeicheneingeschlosseneZeichenfolge,dieSieanderBefehlszeileeingeben,alsBefehlssatzzurInterpre-tationdurchMSIzuübergeben.
                SiemüssenIhreBefehlszeileneintrgeindop-pelteAnführungszeicheneinschlieen.
                GebenSieeindoppeltesAnführungszei-chennach/vundamEndederBefehlszeileein.
                Beispiel:VMware-viewagent-y.
                y.
                y-xxxxxx.
                exe/s/v"Befehlszeilenop-tionen"DamitdasMSI-InstallationsprogrammeineZeichenfolgemitLeerzeichenrich-tigauswertet,müssenSiedieZeichenfolgeinzweiStzedoppelterAnführungs-zeicheneinschlieen.
                Angenommen,SiemchtendieView-Komponenteinei-nemPfadinstallieren,dessenNameLeerzeichenenthlt.
                Beispiel:VMware-viewconnectionserver-y.
                y.
                y-xxxxxx.
                exe/s/v"Be-fehlszeilenoptionenINSTALLDIR=""d:\abc\myfolder"""IndiesemBeispielübergibtdasMSI-InstallationsprogrammdenVerzeichnis-pfadfürdieInstallationundversuchtnicht,dieZeichenfolgealsBefehlszeile-noptionenauszuwerten.
                BeachtenSiediezweifachgesetztendoppeltenAnfüh-rungszeichen,diediegesamteBefehlszeileumschlieen.
                DieOption/v"Befehlszeilenoptionen"isterforderlich,umeineunbeauf-sichtigteInstallationdurchzuführen.
                SiesteuerndieverbleibendenSchritteeinerunbeaufsichtigtenInstallation,indemSieBefehlszeilenoptionenundMSI-EigenschaftenwerteandenMSIInstaller,msiexec.
                exe,übergeben.
                DasMSI-InstallationsprogrammumfasstdenInstallationscodederView-Komponente.
                DerInstallerverwendetdieindieBefehlszeileeinge-gebenenWerteundOptionen,umdieInstallationsauswahlunddiefürdieView-KomponentespezifischenSetup-Optionenauszuwerten.
                Tabelle2-4zeigtdieBefehlszeilenoptionenundMSI-Eigenschaftenwerte,dieandasMSI-Installationspro-grammübergebenwerden.
                Tabelle24.
                MSI-BefehlszeilenoptionenundMSI-EigenschaftenMSI-Optionoder-EigenschaftBeschreibung/qnWeistdenMSIInstalleran,keineSeitendesInstallations-Assistentenanzu-zeigen.
                Angenommen,SiemchtenViewAgentunbeaufsichtigtinstallierenundnurstandardmigeSetup-OptionenundFunktionenverwenden:VMware-viewagent-y.
                y.
                y-xxxxxx.
                exe/s/v"/qn"IndenBeispielenstehtxxxxxxfürdieBuild-Nummerundy.
                y.
                yfürdieVer-sionsnummer.
                AlternativknnenSiedieOption/qbzurAnzeigederAssistentenseitenineinernichtinteraktiven,automatisiertenInstallationverwenden.
                WhrenddieInstallationdurchgeführtwird,werdendieAssistentenseitenange-zeigt,SieknnenjedochkeineEingabenvornehmen.
                DieOption/qnoder/qbisterforderlich,umeineunbeaufsichtigteInstalla-tiondurchzuführen.
                INSTALLDIR(Optional)GibteinenalternativenInstallationspfadfürdieView-Kompo-nentean.
                VerwendenSiedasFormatINSTALLDIR=Pfad,umdenInstallationspfadanzugeben.
                SieknnendieseMSI-Eigenschaftignorieren,wennSiedieView-KomponenteimStandardpfadinstallierenmchten.
                VerwendungvonVMwareViewHorizonClientfürWindows26VMware,Inc.
                Tabelle24.
                MSI-BefehlszeilenoptionenundMSI-Eigenschaften(Fortsetzung)MSI-Optionoder-EigenschaftBeschreibungADDLOCAL(Optional)LegtdiekomponentenspezifischenFunktionenfest,dieinstal-liertwerdensollen.
                IneinerinteraktivenInstallationzeigtdasView-Instal-lationsprogrammAuswahloptionenfürdasbenutzerdefinierteSetupan.
                MithilfederMSI-EigenschaftADDLOCALknnenSiedieseSetup-OptionenanderBefehlszeileangeben.
                UmalleverfügbarenOptionenfüreinbenutzerdefiniertesSetupzuinstal-lieren,gebenSieADDLOCAL=ALLein.
                Beispiel:VMware-viewagent-y.
                y.
                y-xxxxxx.
                exe/s/v"/qnADDLO-CAL=ALL"WennSiedieMSI-EigenschaftADDLOCALnichtverwenden,werdendiestandardmigenSetup-Optioneninstalliert.
                ZurFestlegungeinzelnerSetup-OptionengebenSieeineListederSetup-Optionenein.
                TrennenSiehierbeidieNamenderOptionendurchKomma-ta.
                VerwendenSiezwischendenNamenkeineLeerzeichen.
                VerwendenSiedasFormatADDLOCAL=Wert,Wert,Wert.
                .
                .
                .
                Angenommen,SiemchtenViewAgentmitdenViewComposerAgent-undPCoIP-FunktionenineinemGastbetriebssysteminstallieren:VMware-viewagent-y.
                y.
                y-xxxxxx.
                exe/s/v"/qnADDLO-CAL=Core,SVIAgent,PCoIP"HINWEISDieFunktionCoreistinViewAgenterforderlich.
                LOGINASCURRENTUSER_DISPLAY(Optional)Legtfest,obdasKontrollkstchenAlsaktuellerBenutzeran-meldenimDialogfeldfürdieHorizonViewClient-Verbindungangezeigtwird.
                GültigeWertesind1(aktiviert)und0(deaktiviert).
                DerStandardwertist1,womitdasKontrollkstchensichtbaristunddieBenutzerdiesesKontroll-kstchenaktivierenoderdeaktivierensowiedenzugehrigenStandard-wertauerKraftsetzenknnen.
                WirddasKontrollkstchenausgeblendet,knnenBenutzerdenStandardwertimDialogfeldfürdieHorizonViewClient-Verbindungnichtndern.
                LOGINASCURRENTUSER_DEFAULT(Optional)BestimmtdenStandardwertdesKontrollkstchensAlsaktuel-lerBenutzeranmeldenimDialogfeldfürdieHorizonViewClient-Verbin-dung.
                GültigeWertesind1(aktiviert)und0(deaktiviert).
                EsistkeinStan-dardwertfestgelegt.
                Diesbedeutet,dassdasKontrollkstchendeaktiviertistunddieBenutzerIdentitts-undAnmeldeinformationenmehrereMaleeingebenmüssen,bevorsieaufeinenRemote-Desktopzugreifenknnen.
                WenndasKontrollkstchenAlsaktuellerBenutzeranmeldenaktiviertist,werdendieIdentittunddieAnmeldeinformationendesBenutzers,diedieserzurAnmeldungamClientsystemverwendet,andieView-Verbin-dungsserver-InstanzundschlielichandenRemote-Desktopübergeben.
                VerwendenSiedieseOptioninKombinationmitderOptionLOGINASCURRENTUSER_DISPLAY.
                Beispiel:LOGINASCURRENTUSER_DIS-PLAY=1LOGINASCURRENTUSER_DEFAULT=1WenneinBenutzerHorizonViewClientüberdieBefehlszeileausführtunddieOptionlogInAsCurrentUserangibt,wirddieseEinstellungdurchdeneingegebenenWertüberschrieben.
                Kapitel2InstallationvonViewClientfürWindowsVMware,Inc.
                27Tabelle24.
                MSI-BefehlszeilenoptionenundMSI-Eigenschaften(Fortsetzung)MSI-Optionoder-EigenschaftBeschreibungREBOOT(Optional)SieknnendieOptionREBOOT=ReallySuppressverwenden,umdieAusführungvonSystemkonfigurationsaufgabenzuzulassen,bevordasSystemneugestartetwird.
                /l*vProtokolldatei(Optional)SchreibtProtokollinformationenindieangegebeneProtokollda-tei.
                Beispiel:/l*v""%TEMP%\vmmsi.
                log""IndiesemBeispielwirdeinedetaillierteProtokolldateigeneriert,diedemProtokollhnelt,daswhrendeinerinteraktivenInstallationerstelltwird.
                SieknnendieseOptiondazuverwenden,benutzerdefinierteFunktionenaufzuzeichnen,diemglicherweisenurfürIhreInstallationgelten.
                Siekn-nendieaufgezeichnetenInformationendazuverwenden,Installations-funktionenfürunbeaufsichtigteInstallationenanzugeben.
                Beispiel:InstallationsbeispieleIndenfolgendenBeispielenstehtxxxxxxfürdieBuild-Nummer,y.
                y.
                yfürdieVersionsnummer,in-stall_folderfürdenPfadzumInstallationsordnersowieview.
                mycompany.
                comfürdenNameneinerfiktivenView-Verbindungsserver-Instanz.
                Standardinstallationsbeispiel:VMware-Horizon-View-Client-x86_64-y.
                y.
                y-xxxxxx.
                exe/s/v"/qnREBOOT=ReallySuppressINSTALLDIR=install_folderADDLOCAL=ALLDESKTOP_SHORTCUT=1STARTME-NU_SHORTCUT=1VDM_SERVER=view.
                mycompany.
                com/l*v"%TEMP%\log.
                txt""Installations-undKonfigurationsbeispielfürdieFunktionAlsaktuellerBenutzeranmelden":VMware-Horizon-View-Client-x86_64-y.
                y.
                y-xxxxxx.
                exe/s/v"/qnREBOOT=ReallySuppressINSTALLDIR=install_folderADDLOCAL=TSSOLOGINASCURRENTU-SER_DISPLAY=1LOGINASCURRENTUSER_DEFAULT=1DESKTOP_SHORTCUT=1STARTMENU_SHORTCUT=1VDM_SER-VER=view.
                mycompany.
                com/l*v"%TEMP%\log.
                txt""VerwendungvonVMwareViewHorizonClientfürWindows28VMware,Inc.
                KonfigurierenvonHorizonViewClientfürEndbenutzer3HorizonViewClientbietetmehrereKonfigurationsmechanismenzurVereinfachungderAnmeldungundDesktop-AuswahlundVerbesserungderBenutzererfahrungsowiezurDurchsetzungderSicherheitsrichtli-nien.
                InderfolgendenTabellewerdeneinigeKonfigurationseinstellungenbeschrieben,dieSieaufverschiedeneWeisefestlegenknnen.
                FürvieleandereKonfigurationseinstellungenmüssenSieeinenganzbestimmtenMechanismusverwenden.
                BeispielsweisemüssenSiefürdieEinstellungDisableToastNotifications"(Toastnachrichtendeaktivieren)eineGruppenrichtlinieneinstellungverwenden.
                Tabelle31.
                AllgemeineKonfigurationseinstellungenEinstellungKonfigurationsmechanismenAdressedesView-VerbindungsserversURI,Gruppenrichtlinie,Befehlszeile,Windows-RegistrierungActiveDirectory-BenutzernameURI,Gruppenrichtlinie,Befehlszeile,Windows-RegistrierungAlsaktuellerBenutzeranmeldenGruppenrichtlinie,BefehlszeileDomnennameURI,Gruppenrichtlinie,Befehlszeile,Windows-RegistrierungDesktopanzeigenameURI,Gruppenrichtlinie,BefehlszeileFenstergreURI,Gruppenrichtlinie,BefehlszeileAnzeigeprotokollURI,BefehlszeileOptionenzurUmleitungvonUSB-Ge-rtenURI,Gruppenrichtlinie,BefehlszeileKonfigurierenderZertifikatsprüfungGruppenrichtlinie,Windows-RegistrierungKonfigurierenvonSSL-ProtokollenundkryptografischenAlgorithmenGruppenrichtlinie,Windows-RegistrierungDiesesKapitelbehandeltdiefolgendenThemen:nVerwendenvonURIszurKonfigurationvonHorizonViewClient",aufSeite30nKonfigurierenderZertifikatsprüfungenfürEndbenutzer",aufSeite34nKonfigurierenvonVMwareHorizonViewClientfürWindowsmithilfederGruppenrichtlinienvorla-ge",aufSeite37nAusführenvonViewClientausderBefehlszeile",aufSeite49nKonfigurierendesHorizonViewClientmithilfederWindows-Registrierung",aufSeite52VMware,Inc.
                29VerwendenvonURIszurKonfigurationvonHorizonViewClientMithilfesogenannterUniformResourceIdentifiers(URIs)knnenSieeineWebseiteoderE-Mailmitver-schiedenenVerknüpfungenerstellen,aufdiedieEndbenutzerzumStartvonHorizonViewClient,zurVer-bindungmitdemView-VerbindungsserveroderzumStarteinesbestimmtenDesktopsmitbestimmtenKonfigurationsoptionenklicken.
                SieknnendieAnmeldungamRemote-DesktopdurchErstellenvonWeb-oderE-Mail-VerknüpfungenfürdieEndbenutzerdeutlichvereinfachen.
                DieseVerknüpfungenwerdendurchdieGenerierungvonURIser-stellt,dieeinigeoderallederfolgendenInformationenbereitstellen,sodassdieEndbenutzerdiesenichtan-gebenmüssen:nAdressedesView-VerbindungsserversnPortnummerfürdenView-VerbindungsservernActiveDirectory-BenutzernamenRADIUS-oderRSASecurID-Benutzername,fallsdiesernichtmitdemActiveDirectory-BenutzernamenidentischistnDomnennamenDesktopanzeigenamenFenstergrenDesktop-Aktionen,darunterZurücksetzen",Abmelden"undSitzungstarten"nAnzeigeprotokollnOptionenzurUmleitungvonUSB-GertenWICHTIGUmdieseFunktionnutzenzuknnen,müssenSieüberHorizonViewClient2.
                0oderhherverfü-gen.
                VerwendenSiezurGenerierungeinesURIdasURI-Schemavmware-viewmitHorizonViewClient-spezifi-schenPfad-undAbfragekomponenten.
                HINWEISSieknnenURIsnurzumStartvonHorizonViewClientverwenden,wenndieClientsoftwarebe-reitsaufdenClientcomputernderEndbenutzerinstalliertist.
                SyntaxfürdieErstellungvonvmware-view-URIsDieSyntaxumfasstdasURI-Schemavmware-view,einenPfadauszugzurAngabedesDesktopssowieoptio-naleineAbfragezurAngabederDesktopaktionenoderKonfigurationsoptionen.
                SpezifikationenfürVMwareHorizonView-URIsVerwendenSiezumGenerierenvonURIsfürdenStartvonHorizonViewClientdiefolgendeSyntax:vmware-view://[authority-part][/path-part][query-part]VerwendungvonVMwareViewHorizonClientfürWindows30VMware,Inc.
                DaseinzigerforderlicheElementistdasURI-Schemavmware-view.
                FüreinigeVersionenbestimmterClient-betriebssystememussfürdenNamendesSchemasdieGro-undKleinschreibungbeachtetwerden.
                Ver-wendenSiedahervmware-view.
                WICHTIGInallenAbschnittenmüssenNicht-ASCII-ZeichenzunchstgemUTF-8[STD63]codiertwer-den,anschlieendmussfürjedesOktettderentsprechendenUTF-8-SequenzeineProzentcodierungdurch-geführtwerden,umdiesealsURI-Zeichendarzustellen.
                InformationenzurCodierungvonASCII-ZeichenfindenSieinderURL-Codierungsreferenzunterhttp://www.
                utf8-chartable.
                de/.
                authority-partGibtdieServeradresseundoptionaleinenBenutzernamen,einenichtstan-dardmigePortnummeroderbeidesan.
                DieServernamenmüssenderDNS-Syntaxentsprechen.
                VerwendenSiezurAngabeeinesBenutzernamensdiefolgendeSyntax:user1@server-addressBeachtenSiedabei,dassSiekeineUPN-Adresseangebenknnen.
                HierzuzhltauchdieDomne.
                ZurAngabedesDomnennamensknnenSiedenAbfrageteildomainNameimURIverwenden.
                VerwendenSiezurAngabeeinerPortnummerdiefolgendeSyntax:server-add-ress:port-numberpath-partGibtdenDesktopan.
                VerwendenSiedenAnzeigenamendesDesktops.
                WeistderAnzeigenameeinLeerzeichenauf,müssenSiedenCodierungsme-chanismus%20verwenden,umdasLeerzeichendarzustellen.
                query-partGibtdiezuverwendendenKonfigurationsoptionenoderdiedurchzuführen-denDesktopaktionenan.
                FürdieAbfragenmussdieGro-undKleinschrei-bungnichtbeachtetwerden.
                VerwendenSiefürdenEinsatzmehrererAbfra-gendaskaufmnnischeUnd-Zeichen(&)zwischendenAbfragen.
                SolltendieAbfragenmiteinanderinKonfliktstehen,wirddieletzteAbfrageinderListeverwendet.
                VerwendenSiediefolgendeSyntax:query1=va-lue1[&query2=value2.
                .
                .
                ]Kapitel3KonfigurierenvonHorizonViewClientfürEndbenutzerVMware,Inc.
                31UnterstützteAbfragenIndiesemAbschnittwerdendieAbfragenaufgeführt,diefürdiesenHorizonViewClient-Typunterstütztwerden.
                WennSieURIsfürmehrereClienttypengenerieren,sozumBeispielfürDesktopclientsodermobileClients,findenSiefürjedeArtClientsystemweitereAnweisungenimHandbuchVerwendungvonVMwareHorizonViewClient.
                actionTabelle32.
                Werte,diemitderAbfrageaction"verwendetwerdenknnenWertBeschreibungbrowseZeigteineListederverfügbaren,aufdemangegebenenServergehostetenDesktopsan.
                BeiVerwendungdieserAktionmüssenSiekeinenDesktopangeben.
                start-sessionStartetdenangegebenenDesktop.
                Wennkeineaction"-AbfragebereitgestelltwirdundderDesktopnameangegebenwird,iststart-sessiondieStandardaktion.
                zurücksetzenFhrtdenangegebenenDesktopherunterundstartetihnneu.
                NichtgespeicherteDatengehenverloren.
                DasZurücksetzeneinesRemote-DesktopsentsprichtdemBettigenderReset-Tasteaufei-nemphysischenPC.
                logoffMeldetdenBenutzervomGastbetriebssystemaufdemRemote-Desktopab.
                connectUSBOnInsertVerbindeteinUSB-GertbeimAnschlieendesGertsmitdemimVorder-grundangezeigtenDesktop.
                DieseAbfragewirdbedingungslosfestgelegt,wennSiedieAbfrageunattendedangeben.
                ZurVerwendungdieserAbfragemüssenSiedieAbfrageactionaufstart-sessionsetzenoderohnedieAb-frageactionarbeiten.
                GültigeWertesindyesundno.
                EinBeispielfürdieSyntaxistetwaconnectUSBOnInsert=yes.
                connectUSBOnStartupLeitetalleaktuellmitdemClientsystemverbundenenUSB-GerteandenDesktopum.
                DieseAbfragewirdbedingungslosfestgelegt,wennSiedieAb-frageunattendedangeben.
                ZurVerwendungdieserAbfragemüssenSiedieAbfrageactionaufstart-sessionsetzenoderohnedieAbfrageactionar-beiten.
                GültigeWertesindyesundno.
                EinBeispielfürdieSyntaxistetwaconnectUSBOnStartup=yes.
                desktopLayoutLegtdieGredesFenstersfürdieAnzeigedesRemote-Desktopsfest.
                ZurVerwendungdieserAbfragemüssenSiedieAbfrageactionaufstart-sessionsetzenoderohnedieAbfrageactionarbeiten.
                Tabelle33.
                GültigeWertefürdesktopLayout-AbfrageWertBeschreibungfullscreenVollbildaufeinemMonitor.
                HierbeihandeltessichumdieStandardeinstellung.
                multimonitorVollbildaufallenMonitoren.
                windowLargeGroesFenster.
                windowSmallKleinesFenster.
                WxHBenutzerdefinierteAuflsung,beiderSiedieBreitemalHheinPixelangeben.
                EinBeispielfürdieSyntaxistetwadesktopLayout=1280x800.
                desktopProtocolGültigeWertesindRDPundPCoIP.
                ZurAngabevonPCoIPverwendenSiebeispielsweisedieSyntaxdesktopProtocol=PCoIP.
                VerwendungvonVMwareViewHorizonClientfürWindows32VMware,Inc.
                domainNameDieDomne,diemitdemBenutzerverknüpftist,dereineVerbindungzumRemote-Desktopherstellt.
                tokenUserNameGibtdenRSA-oderRADIUS-Benutzernamenan.
                VerwendenSiedieseAb-fragenur,wennderRSA-oderRADIUS-BenutzernamenichtmitdemActiveDirectory-Benutzernamenidentischist.
                WennSiedieseAbfragenichtange-benunddieRSA-oderRADIUS-Authentifizierungerforderlichist,wirdderWindows-Benutzernameverwendet.
                DieSyntaxlautettokenUserName=name.
                unattendedErstellteineSerververbindungimKioskmodus.
                GebenSiekeineBenutzerin-formationenan,wennSiedieseAbfrageverwenden.
                Beispielefürvmware-view-URIsSieknnenHypertext-LinksoderSchaltflchenmitdemURI-Schemavmware-viewerstellenunddieseLinksinE-MailsoderaufeinerWebseiteeinbinden.
                IhreEndbenutzerknnendannaufdieseLinksklicken,umbeispielsweiseeinenbestimmtenRemote-DesktopmitdenvonIhnenangegebenenStartoptionenzustarten.
                URI-SyntaxbeispieleNachjedemURI-BeispielfindenSieeineBeschreibung,wasderEndbenutzernachAnklickendesURI-Linkssieht.
                1vmware-view://view.
                mycompany.
                com/Primary%20Desktopaction=start-sessionHorizonViewClientwirdgestartetundstellteineVerbindungmitdemServerview.
                mycompany.
                comher.
                DasAnmeldefeldfordertdenBenutzerzurEingabevonBenutzernamen,DomnennamenundKenn-wortauf.
                NacheinererfolgreichenAnmeldungstelltderClienteineVerbindungzumDesktopher,des-senAnzeigenamealsPrimaryDesktopangezeigtwird.
                DerBenutzeristdannbeimGast-Betriebssys-temangemeldet.
                HINWEISDieStandardvorgabenfürdasAnzeigeprotokollunddieFenstergrewerdenverwendet.
                DasStandardanzeigeprotokollistPCoIP.
                DieStandardfenstergreistVollbild.
                2vmware-view://view.
                mycompany.
                com:7555/Primary%20DesktopDieserURIhatdiegleicheWirkungwieimvorherigenBeispiel,auerdasserdennichtstandardmi-genPort7555fürdenView-Verbindungsserververwendet.
                (DerstandardmigePortlautet443.
                )DaeineDesktop-IDbereitgestelltwird,wirdderDesktopgestartet,obwohldieAktionstart-sessionnichtimURIenthaltenist.
                3vmware-view://fred@view.
                mycompany.
                com/Finance%20DesktopdesktopProtocol=PCoIPHorizonViewClientwirdgestartetundstellteineVerbindungmitdemServerview.
                mycompany.
                comher.
                ImAnmeldefeldwirddasTextfeldBenutzernamemitdemNamenfredgefüllt.
                DerBenutzermussdenDomnennamenunddasKennworteingeben.
                NacheinererfolgreichenAnmeldungstelltderClientei-neVerbindungzumDesktopher,dessenAnzeigenamealsFinanceDesktopangezeigtwird.
                DerBe-nutzeristdannbeimGast-Betriebssystemangemeldet.
                DieVerbindungnutztdasPCoIP-Anzeigeproto-koll.
                4vmware-view://fred@view.
                mycompany.
                com/Finance%20DesktopdomainName=mycompanyHorizonViewClientwirdgestartetundstellteineVerbindungmitdemServerview.
                mycompany.
                comher.
                ImAnmeldefeldwirddasTextfeldBenutzernamemitdemNamenfredunddasTextfeldDomnemitmycompanygefüllt.
                DerBenutzermussdasKennworteingeben.
                NacheinererfolgreichenAnmeldungstelltderClienteineVerbindungzumDesktopher,dessenAnzeigenamealsFinanceDesktopange-zeigtwird.
                DerBenutzeristdannbeimGast-Betriebssystemangemeldet.
                Kapitel3KonfigurierenvonHorizonViewClientfürEndbenutzerVMware,Inc.
                335vmware-view://view.
                mycompany.
                com/HorizonViewClientwirdgestartetundderBenutzerwirdandieAnmeldeaufforderungfürdieVer-bindungmitdemServerview.
                mycompany.
                comweitergeleitet.
                6vmware-view://view.
                mycompany.
                com/Primary%20Desktopaction=resetHorizonViewClientwirdgestartetundstellteineVerbindungmitdemServerview.
                mycompany.
                comher.
                DasAnmeldefeldfordertdenBenutzerzurEingabevonBenutzernamen,DomnennamenundKenn-wortauf.
                NacheinererfolgreichenAnmeldungzeigtHorizonViewClienteinDialogfeldan,indemderBenutzeraufgefordertwird,dasZurücksetzenfürPrimaryDesktop"zubesttigen.
                NachdemZurück-setzenwirdjenachClienttypeineMeldungangezeigt,dieüberdenErfolgdesZurücksetzensinfor-miert.
                HINWEISDieseAktionistnurverfügbar,wenndieFunktionvomView-AdministratorfürdenEndbe-nutzeraktiviertwurde.
                7vmware-view://view.
                mycompany.
                com/Primary%20Desktopaction=start-session&connectUSBOnStart-up=trueDieserURIhatdiegleicheWirkungwiedasersteBeispiel,undalleandasClientsystemangeschlosse-nenUSB-GertewerdenandenRemote-Desktopumgeleitet.
                8vmware-view://HorizonViewClientwirdgestartetundderBenutzerwirdzuderSeiteweitergeleitet,aufderdieAd-resseeinerView-Verbindungsserver-Instanzeingegebenwerdenkann.
                BeispielfürHTML-CodeSieknnenURIsverwenden,umHypertext-LinksundSchaltflchenzuerstellen,dieinE-MailsoderaufWebseiteneingebundenwerdenknnen.
                DiefolgendenBeispieleveranschaulichen,wieSiedenURIausdemerstenBeispielverwenden,umeinenHypertext-LinkmitdemTextTestLinkbesagtundeineSchalt-flchemitdemTextTestButtonzucodieren.
                TestLinkKonfigurierenderZertifikatsprüfungenfürEndbenutzerAdministratorenknnendenZertifikatüberprüfungsmodussokonfigurieren,dassbeispielsweiseimmerdievollstndigeberprüfungdurchgeführtwird.
                DieZertifikatsprüfungwirdfürSSL-VerbindungenzwischenView-VerbindungsserverundHorizonViewClientdurchgeführt.
                DieAdministratorenknnendenberprüfungsmodussokonfigurieren,dasseinederfolgendenStrategienverwendetwird:nDieEndbenutzerwhlenselbstdenberprüfungsmodus.
                InderrestlichenListewerdendiedreiber-prüfungsmodibeschrieben.
                n(Keineberprüfung)EswerdenkeineZertifikatsprüfungendurchgeführt.
                VerwendungvonVMwareViewHorizonClientfürWindows34VMware,Inc.
                n(Warnen)DieEndbenutzerwerdengewarnt,wennderServereinselbstsigniertesZertifikatvorlegt.
                DieBenutzerknnendannselbstentscheiden,obsiediesenVerbindungstypzulassen.
                n(VolleSicherheit)Eswirdeinevollstndigeberprüfungdurchgeführt.
                DieVerbindungen,fürdiedie-sePrüfungnichterfolgreichverluft,werdenabgelehnt.
                EinzelheitenzudenverschiedenenArtenderdurchgeführtenberprüfungenfindenSieunterZertifikat-sprüfungsmodifürHorizonViewClient",aufSeite35.
                VerwendenSiedieADM-VorlagendateizurClient-Konfiguration,umdenberprüfungsmoduseinzustel-len.
                DieADM-Vorlagendatei(vdm_client.
                adm)fürdieVMwareHorizonViewClient-KonfigurationistimVerzeichnisInstallationsverzeichnis\VMware\VMwareHorizonViewClient\extras\aufdemClientsysteminstalliert.
                DasInstallationsverzeichnislautetstandardmigC:\Programme(x86).
                InformationenzumFestlegenderGPO-EinstellungenmithilfedieserVorlagefindenSieunterKonfigurierenvonVMwareHo-rizonViewClientfürWindowsmithilfederGruppenrichtlinienvorlage",aufSeite37.
                HINWEISMitderADM-VorlagendateifürdieClient-KonfigurationknnenSieauchdieVerwendungbe-stimmterkryptografischerAlgorithmenundProtokollebeschrnken,bevorSieeineverschlüsselteSSL-Ver-bindungherstellen.
                WeitereInformationenzudieserEinstellungfindenSieunterSicherheitseinstellungenfürClient-GPOs",aufSeite38.
                WennSiedieEinstellungfürdieZertifikatüberprüfungnichtalsGruppenrichtliniekonfigurierenmchten,knnenSiedieZertifikatüberprüfungauchdurchHinzufügendesWertnamensCertCheckModezueinemderfolgendenRegistrierungsschlüsselaufdemClientcomputeraktivieren:n32-Bit-Windows:HKEY_LOCAL_MACHINE\Software\VMware,Inc.
                \VMwareVDM\Client\Securityn64-Bit-Windows:HKLM\SOFTWARE\Wow6432Node\VMware,Inc.
                \VMwareVDM\Client\SecurityVerwendenSiediefolgendenWerteimRegistrierungsschlüssel:n0implementiertServer-Identittszertifikatenichtüberprüfen.
                n1implementiertWarnungvorVerbindungmitnichtvertrauenswürdigenServernausgeben.
                n2implementiertNiemitnichtvertrauenswürdigenServernverbinden.
                WennSiesowohldieGruppenrichtlinieneinstellungalsauchdieEinstellungCertCheckModeimRegistrie-rungsschlüsselkonfigurieren,hatdieGruppenrichtlinieneinstellungVorrangvorderRegistrierungsschlüs-seleinstellung.
                ZertifikatsprüfungsmodifürHorizonViewClientAdministratorenundmanchmalauchEndbenutzerknnenübereineKonfigurationfestlegen,obClient-Verbindungenabgelehntwerdensollen,wennbeiZertifikatsüberprüfungenFehlerauftreten.
                DieZertifikatsprüfungwirdfürSSL-VerbindungenzwischenView-VerbindungsserverundHorizonViewClientdurchgeführt.
                DieZertifikatsüberprüfungumfasstdiefolgendenChecks:nWurdedasZertifikatwiderrufennIstdasZertifikatfüreinenanderenZweckbestimmtalsfürdieberprüfungderIdentittdesAbsen-dersunddieVerschlüsselungderServerkommunikationMitanderenWorten:HandeltessichumdenkorrektenZertifikattypnIstdasZertifikatabgelaufenodererstzukünftiggültigMitanderenWorten:IstdasZertifikatlautComputeruhrgültignStimmtderallgemeineNameaufdemZertifikatmitdemHostnamendesServersüberein,deressen-detZueinerfehlendenbereinstimmungkanneskommen,wenneinLastenausgleichHorizonViewClientaneinenServermiteinemZertifikatumleitet,dasnichtmitdeminHorizonViewClienteingegebenenHostnamenübereinstimmt.
                EinweiterermglicherGrundfüreinefehlendebereinstimmungistdieEingabeeinerIP-AdressestatteinesHostnamensimClient.
                Kapitel3KonfigurierenvonHorizonViewClientfürEndbenutzerVMware,Inc.
                35nIstdasZertifikatvoneinerunbekanntenodernichtalsvertrauenswürdigeingestuftenZertifizierungs-stelle(CA)signiertwordenSelbstsignierteZertifikatesindeinTypdernichtalsvertrauenswürdigein-gestuftenCA.
                UmdiesePrüfungzubestehen,musssichdasStammzertifikatfürdieZertifikatvertrauensketteimlo-kalenZertifikatspeicherdesGertsbefinden.
                HINWEISAnweisungenzurVerteilungeinesselbstsigniertenStammzertifikatsanalleWindows-Clientsyste-meineinerDomnefindenSieunterdemThemaStammzertifikatzudenvertrauenswürdigenZertifizie-rungsstellenhinzufügen"imDokumentInstallationvonVMwareHorizonView‐.
                WennIhrAdministratorIhnendieVerwendungvonHorizonViewClientbeiderAnmeldunganeinemDesktopermglichthat,knnenSieaufSSLkonfigurierenklickenunddenZertifikatsprüfungsmodusein-stellen.
                SiehabendreiAuswahlmglichkeiten:nNiemitnichtvertrauenswürdigenServernverbinden.
                SollteeinebeliebigederZertifikatsprüfungenfehlschlagen,kannderClientkeineVerbindungmitdemServerherstellen.
                DienichtbestandenenPrüf-ungenwerdenineinerFehlermeldungaufgelistet.
                nWarnungvorVerbindungmitnichtvertrauenswürdigenServernausgeben.
                WenneineZertifikats-prüfungfehlschlgt,weilderServereinselbstsigniertesZertifikatverwendet,knnenSieaufWeiterklicken,umdieWarnungzuignorieren.
                BeiselbstsigniertenZertifikatenmussderZertifikatsnamenichtmitdemNamendesView-Verbindungsserversübereinstimmen,denSieinHorizonViewClienteingegebenhaben.
                MglicherweiseerhaltenSieaucheineWarnung,wenndasZertifikatabgelaufenist.
                nServer-Identittszertifikatenichtüberprüfen.
                BeiAktivierungdieserOptionführtViewkeineZertifi-katsüberprüfungdurch.
                IstderZertifikatsprüfungsmodusaufWarnengesetzt,knnenSieimmernocheineVerbindungmiteinerView-Verbindungsserverinstanzherstellen,dieeinselbstsigniertesZertifikatverwendet.
                InstallierteinAdministratorsptereinSicherheitszertifikatvoneinervertrauenswürdigenZertifikatsautori-tt,sodassalleZertifikatsüberprüfungenbeiderVerbindungsherstellungbestandenwerden,wirddiesever-trauenswürdigeVerbindungfürdiesenspeziellenServervorgemerkt.
                LegtdieserServerinZukunftwiedereinselbstsigniertesZertifikatvor,schlgtdieVerbindungfehl.
                NachdemeinbestimmterServereinvollstn-digüberprüfbaresZertifikatvorgelegthat,musserdiesauchinZukunftimmersohandhaben.
                WICHTIGInfrüherenVersionenkonfiguriertenSiedieClientsystemeIhresUnternehmensso,dasssieüberGPOeinbestimmtesVerschlüsselungsverfahrenverwendeten,indemSiealsGruppenrichtlinieneinstellungdieReihenfolgederSSL-Verschlüsselungssammlungenkonfigurierten.
                NunmüssenSiedafüreineGrup-penrichtlinien-SicherheitseinstellungvonHorizonViewClient2.
                3verwenden,dieinderADM-Vorlagenda-teifürHorizonViewenthaltenist.
                SieheSicherheitseinstellungenfürClient-GPOs",aufSeite38.
                Alterna-tivknnenSieauchdieRegistrierungseinstellungSSLCipherListaufdemClientverwenden.
                SieheKonfi-gurierendesHorizonViewClientmithilfederWindows-Registrierung",aufSeite52.
                VerwendungvonVMwareViewHorizonClientfürWindows36VMware,Inc.
                KonfigurierenvonVMwareHorizonViewClientfürWindowsmithilfederGruppenrichtlinienvorlageVMwareHorizonViewCliententhlteineGruppenrichtlinien-Verwaltungsvorlage(ADM-Datei)zumKon-figurierenvonVMwareHorizonViewClient.
                SieknnenRemote-Desktop-Verbindungenoptimierenundschützen,indemSiedieRichtlinieneinstellungenindieserADM-Vorlagendateizueinemneuenodervor-handenenGruppenrichtlinienobjekt(GroupPolicyObject,GPO)inActiveDirectoryhinzufügen.
                DieHorizonView-ADM-VorlagendateienenthaltensowohlGruppenrichtlinienfürdieComputerkonfigura-tionalsauchGruppenrichtlinienfürdieBenutzerkonfiguration.
                nRichtlinienfürdieComputerkonfigurationgeltenfürHorizonViewClient,unabhngigdavon,werdenClientaufdemHostausführt.
                nMitRichtlinienfürdieBenutzerkonfigurationwerdenHorizonViewClient-Richtlinienfestgelegt,diefüralleBenutzergelten,dieHorizonViewClientausführen,sowieRDP-Verbindungseinstellungen.
                RichtlinienfürdieBenutzerkonfigurationsetzengleichwertigeRichtlinienfürdieComputerkonfigura-tionauerKraft.
                HorizonViewwendetRichtlinienbeimStarteinesDesktopsundbeiderBenutzeranmeldungan.
                DieADM-Vorlagendatei(vdm_client.
                adm)fürdieHorizonViewClient-KonfigurationwirdimVerzeichnisInstallationsverzeichnis\VMware\VMwareHorizonViewClient\extras\aufdemClientsysteminstalliert.
                DasInstallationsverzeichnislautetstandardmigC:\Programme(x86)aufeinem64-Bit-Systembzw.
                C:\Programmebeieinem32-Bit-System.
                SiemüssendieseDateiaufIhrenActiveDirectory-ServerkopierenunddieseVerwaltungsvorlagemithilfedesGruppenrichtlinienverwaltungs-Editorshinzufügen.
                Anweisun-genhierzufindenSieunterdemThemaHinzufügenvonView-ADM-VorlagenzueinemGPO"imDoku-mentVerwaltungvonVMwareHorizonViewClient.
                EinstellungenfürdieSkriptdefinitionfürClient-GPOsSieknnenRichtlinienfürvielederEinstellungenfestlegen,diebeimAusführenvonVMwareHorizonViewClientüberdieBefehlszeileverwendetwerden,wiebeispielsweisedieDesktop-Gre,denNamenoderdenDomnennamen.
                InderfolgendenTabellewerdendieinderADM-VorlagendateifürdieVMwareHorizonViewClient-Kon-figurationenthaltenenEinstellungenfürdieSkriptdefinitionbeschrieben.
                DieVorlagestelltfürjedeSkript-definitioneineVersionfürdieComputerkonfigurationundeineVersionfürdieBenutzerkonfigurationbe-reit.
                DieEinstellungfürdieBenutzerkonfigurationsetzthierbeidiequivalenteEinstellungfürdieCompu-terkonfigurationauerKraft.
                Tabelle34.
                VMwareHorizonViewClient-Konfigurationsvorlage:SkriptdefinitionenEinstellungBeschreibungAutomaticallyconnectifonlyonelaunchitemisentitled(HorizonViewClient2.
                3oderhher)StelltautomatischeineVerbin-dungzumDesktopher,wennderBenutzernurAnspruchaufeinenDesktophat.
                DemBenutzerwirddadurchdieAuswahldesDesktopsauseinerListemitnureinemDesktoperspart.
                ConnectallUSBdevicestothedesk-toponlaunchLegtfest,oballederverfügbarenUSB-GerteaufdemClientsystemmitdemDesktopverbundenwerden,wenndiesergestartetwird.
                ConnectallUSBdevicestothedesk-topwhentheyarepluggedinLegtfest,obUSB-GertemitdemDesktopverbundenwerden,wenndieGerteandasClientsystemangeschlossenwerden.
                Kapitel3KonfigurierenvonHorizonViewClientfürEndbenutzerVMware,Inc.
                37Tabelle34.
                VMwareHorizonViewClient-Konfigurationsvorlage:Skriptdefinitionen(Fortsetzung)EinstellungBeschreibungDesktopLayoutLegtdasLayoutdesVMwareHorizonViewClient-Fenstersfest,dasei-nemBenutzerbeiderAnmeldunganeinemRemote-Desktopangezeigtwird.
                EsstehenfolgendeOptionenzurAuswahl:nVollbildnMehrereMonitorenFenster-gronFenster-kleinDieseEinstellungistnurverfügbar,wenndieEinstellungDesktopNametoselectebenfallsgesetztist.
                DesktopNametoselectLegtdenvonVMwareHorizonViewClientwhrendderAnmeldungverwendetenStandard-Desktopfest.
                Disable3rd-partyTerminalServicespluginsLegtfest,obTerminaldienste-Plug-InsvonDrittanbietern,diealsnor-maleRDP-Plug-Insinstalliertsind,vonVMwareHorizonViewClientüberprüftwerden.
                WennSiedieseEinstellungnichtkonfigurieren,über-prüftVMwareHorizonViewClientstandardmigPlug-InsvonDrit-tanbietern.
                DieseEinstellunghatkeineAuswirkungaufHorizonView-spezifischePlug-Ins,wiebeispielsweisedieUSB-Umleitung.
                LogonDomainNameLegtdievonHorizonViewClientwhrendderAnmeldungverwendeteNetBIOS-Domnefest.
                LogonPasswordLegtdasvonHorizonViewClientwhrendderAnmeldungverwende-teKennwortfest.
                DasKennwortwirdvonActiveDirectoryimTextfor-matgespeichert.
                LogonUserNameLegtdenvonHorizonViewClientwhrendderAnmeldungverwende-tenBenutzernamenfest.
                ServerURLLegtdievonHorizonViewClientwhrendderAnmeldungverwendeteURLfest,z.
                B.
                https://view1.
                beispiel.
                com.
                Suppresserrormessages(nurbeiSkriptverwendung)Legtfest,obHorizonViewClientFehlermeldungenwhrendderAn-meldungunterdrückt.
                DieseEinstellungistnuranwendbar,wennderAnmeldevorgangvoll-stndigperSkriptausgeführtwird,z.
                B.
                wennalleerforderlichenAn-meldeinformationenübereineRichtlinievorausgefülltwerden.
                WenndieAnmeldungaufgrundvonfalschenAnmeldeinformationenfehlschlgt,wirdderBenutzerhierübernichtbenachrichtigt,undderHorizonViewClient-Prozesswirdbeendet.
                SicherheitseinstellungenfürClient-GPOsZudenSicherheitseinstellungenzhlenOptionenfürdasSicherheitszertifikat,fürAnmeldeinformationenundfürdieSingleSign-On-Funktion(SSO).
                InderfolgendenTabellewerdendieinderADM-VorlagendateifürdieHorizonViewClient-KonfigurationenthaltenenSicherheitseinstellungenbeschrieben.
                DieseTabellezeigt,obdieEinstellungendieEinstellun-genComputerConfiguration(Computerkonfiguration)"undUserConfiguration(Benutzerkonfiguration)"enthaltenodernurdieEinstellungComputerConfiguration(Computerkonfiguration)".
                BeidenSicher-heitseinstellungen,diebeideTypeneinschlieen,setztdieEinstellungfürdieBenutzerkonfigurationhierbeidiequivalenteEinstellungfürdieComputerkonfigurationauerKraft.
                VerwendungvonVMwareViewHorizonClientfürWindows38VMware,Inc.
                Tabelle35.
                HorizonViewClient-Konfigurationsvorlage:SicherheitseinstellungenEinstellungBeschreibungAllowcommandlinecredentials(EinstellungfürdieComputerkonfi-guration)Legtfest,obBenutzeranmeldeinformationenmitHorizonViewClient-Befehls-zeilenoptionenbereitgestelltwerdenknnen.
                WenndieseEinstellungaktiviertist,stehendieOptionensmartCardPINundpasswordnichtzurVerfügung,wennBenutzerHorizonViewClientüberdieBefehlszeileausführen.
                DieseEinstellungiststandardmigaktiviert.
                ServersTrustedForDelegation(VertrauenswürdigeServerfürdieDelegierung)(EinstellungfürdieComputerkonfi-guration)GibtdieView-Verbindungsserver-Instanzenan,welchedieBenutzeridentitts-undAnmeldeinformationenakzeptieren,diebeiAktivierungdesKontrollkst-chensLoginascurrentuser(AnmeldenalsaktuellerBenutzer)übergebenwerden.
                WennSiekeineView-Verbindungsserver-Instanzenangeben,akzeptie-renalleView-Verbindungsserver-InstanzendieseInformationen.
                VerwendenSiezumHinzufügeneinerView-Verbindungsserver-InstanzeinesderfolgendenFormate:ndomain\system$nsystem$@domain.
                comnServicePrincipalName(SPN)desView-Verbindungsserver-DienstesKapitel3KonfigurierenvonHorizonViewClientfürEndbenutzerVMware,Inc.
                39Tabelle35.
                HorizonViewClient-Konfigurationsvorlage:Sicherheitseinstellungen(Fortsetzung)EinstellungBeschreibungCertificateverificationmode(Zertifikatüberprüfungsmodus)(EinstellungfürdieComputerkonfi-guration)KonfiguriertdieEbenederZertifikatsprüfung,diedurchHorizonViewClientdurchgeführtwird.
                EsstehenfolgendeModizurAuswahl:nNoSecurity(KeineSicherheit).
                HorizonViewführtkeineZertifikats-prüfungdurch.
                nWarnButAllow(Warnen,aberzulassen).
                WenndiefolgendenSer-verzertifikatproblemeauftreten,wirdeineWarnungangezeigt,aberderBe-nutzerkannmitderVerbindungsherstellungmitView-Verbindungsserverfortfahren:nVonHorizonViewwirdeinselbstsigniertesZertifikatbereitgestellt.
                IndiesemFallistesakzeptabel,wennderZertifikatnamenichtmitdemNamendesView-Verbindungsserversübereinstimmt,derinHorizonViewClientvomBenutzerangegebenwurde.
                nEinüberprüfbaresZertifikat,dasinIhrerBereitstellungkonfiguriertwurde,istabgelaufenodernochnichtgültig.
                WennandereZertifikatfehlerbedingungenvorliegen,zeigtHorizonVieweinFehlerdialogfeldanundverhindert,dassderBenutzereineVerbindungzumView-Verbindungsserverherstellt.
                WarnButAllow(Warnen,aberzulassen)istderStandardwert.
                nFullSecurity(VolleSicherheit).
                WenneinbeliebigerZertifikatfeh-lerauftritt,kannderBenutzerkeineVerbindungmitView-Verbindungsser-verherstellen.
                HorizonViewzeigtdemBenutzerdieZertifikatfehleran.
                WenndieseGruppenrichtlinieneinstellungkonfiguriertist,knnendieBenutzerdenausgewhltenModusfürdieZertifikatsprüfunginHorizonViewClientse-hen,ihnabernichtkonfigurieren.
                DasDialogfeldfürdieSSL-Konfigurationin-formiertdieBenutzerdarüber,dassderAdministratordieEinstellunggesperrthat.
                WenndieseEinstellungnichtkonfiguriertoderdeaktiviertwurde,knnenHorizonViewClient-BenutzereinenZertifikatsprüfungsmodusauswhlen.
                DamiteinHorizonViewServerdievonHorizonViewClientbereitgestelltenZertifikateprüfenkann,mussderClientHTTPS-VerbindungenzumView-Ver-bindungsserver-oderSicherheitsserver-Hostherstellen.
                DieZertifikatsüberprü-fungwirdnichtunterstützt,wennSieSSLaufeinZwischengertverlagern,wel-chesHTTP-VerbindungenzumView-Verbindungsserver-oderSicherheitsser-ver-Hostherstellt.
                WennSiedieseEinstellungbeiWindows-ClientsnichtalsGruppenrichtliniekonfigurierenmchten,knnenSiedieZertifikatüberprüfungauchdurchHin-zufügendesWertnamensCertCheckModezufolgendenRegistrierungsschlüs-selnaufdemClientcomputeraktivieren:n32-Bit-Windows:HKEY_LOCAL_MACHINE\Software\VMware,Inc.
                \VMwareVDM\Client\Securityn64-Bit-Windows:HKLM\SOFTWARE\Wow6432Node\VMware,Inc.
                \VMwareVDM\Client\SecurityVerwendenSiediefolgendenWerteimRegistrierungsschlüssel:n0implementiertNoSecurity(KeineSicherheit).
                n1implementiertWarnButAllow(Warnen,aberzulassen).
                n2implementiertFullSecurity(VolleSicherheit).
                WennSiesowohldieGruppenrichtlinieneinstellungalsauchdieEinstellungCertCheckModeimRegistrierungsschlüsselkonfigurieren,hatdieGruppen-richtlinieneinstellungVorrangvorderRegistrierungsschlüsseleinstellung.
                VerwendungvonVMwareViewHorizonClientfürWindows40VMware,Inc.
                Tabelle35.
                HorizonViewClient-Konfigurationsvorlage:Sicherheitseinstellungen(Fortsetzung)EinstellungBeschreibungDefaultvalueofthe'Loginascurrentuser'checkbox(EinstellungfürdieComputer-undBenutzerkonfiguration)GibtdenStandardwertdesKontrollkstchensAlsaktuellerBenutzeranmeldenimDialogfeldfürdieHorizonViewClient-Verbindungan.
                DieseEinstellungsetztdenStandardwertauerKraft,derwhrendderHorizonViewClient-Installationangegebenwurde.
                WenneinBenutzerHorizonViewClientüberdieBefehlszeileausführtunddieOptionlogInAsCurrentUserangibt,wirddieseEinstellungdurchdeneinge-gebenenWertüberschrieben.
                WenndasKontrollkstchenAlsaktuellerBenutzeranmeldenaktiviertist,wer-dendieIdentittunddieAnmeldeinformationendesBenutzers,diedieserzurAnmeldungamClientsystemverwendet,andieView-Verbindungsserver-In-stanzundschlielichandenRemote-Desktopübergeben.
                IstdasKontrollkst-chendeaktiviert,müssenBenutzerIdentitts-undAnmeldeinformationenmeh-rereMaleeingeben,bevorsieaufeinenRemote-Desktopzugreifenknnen.
                DieseEinstellungiststandardmigdeaktiviert.
                DisplayoptiontoLoginascurrentuser(EinstellungfürdieComputer-undBenutzerkonfiguration)Legtfest,obdasKontrollkstchenAlsaktuellerBenutzeranmeldenimDialog-feldfürdieHorizonViewClient-Verbindungangezeigtwird.
                BeiAnzeigedesKontrollkstchensknnenBenutzerdieOptionaktivierenoderdeaktivierenoderdenzugehrigenStandardwertauerKraftsetzen.
                WirddasKontrollkstchenausgeblendet,knnenBenutzerdenStandardwertimDialog-feldfürdieHorizonViewClient-Verbindungnichtndern.
                SieknnendenStandardwertfürLoginascurrentuser(Anmeldenalsaktuel-lerBenutzer)überdieRichtlinieneinstellungDefaultvalueofthe'Loginascurrentuser'checkbox(StandardwertdesKontrollkstchens'AnmeldenalsaktuellerBenutzer')festlegen.
                DieseEinstellungiststandardmigaktiviert.
                Enablejumplistintegration(EinstellungfürdieComputerkonfi-guration)Legtfest,obeineSprunglisteimHorizonViewClient-SymbolinderTaskleistevonWindows7oderhherenSystemenangezeigtwerdensoll.
                berdieSprunglisteknnenBenutzereineVerbindungzuzuletztverwendetenView-Verbindungsserver-InstanzenundRemote-Desktopsherstellen.
                WennHorizonViewClientgemeinsamverwendetwird,sollenBenutzermgli-cherweisenichtdieNamenderzuletztverwendetenDesktopssehen.
                DieSprunglisteknnenSiedeaktivieren,indemSiedieseEinstellungdeaktivieren.
                DieseEinstellungiststandardmigaktiviert.
                EnableSSLencryptedframeworkchannel(SSL-verschlüsseltenFramework-Kanalaktivieren)(EinstellungfürdieComputer-undBenutzerkonfiguration)Legtfest,obSSLfürHorizonView5.
                0undltereDesktopsaktiviertwird.
                VorHorizonView5.
                0wurdendieüberdenPortTCP32111andenDesktopgesen-detenDatennichtverschlüsselt.
                nEnable:AktiviertSSL,aberermglichtdasZurücksetzenaufdievorherigeunverschlüsselteVerbindung,fallsderRemote-DesktopSSLnichtunter-stützt.
                BeispielsweisewirdSSLvonHorizonView5.
                0undlterenDesktopsnichtunterstützt.
                EnableistdieStandardeinstellung.
                nDisable:DeaktiviertSSL.
                DieseEinstellungwirdnichtempfohlen.
                SiekannaberhilfreichseinfürdasDebuggingoderwennderKanalnichtgetunneltwirdunddeshalbmglicherweisedurcheinProduktzurWAN-Beschleuni-gungoptimiertwerdenknnte.
                nEnforce:AktiviertSSLundverweigertdasHerstelleneinerVerbindungzuDesktopsohneSSL-Unterstützung.
                Kapitel3KonfigurierenvonHorizonViewClientfürEndbenutzerVMware,Inc.
                41Tabelle35.
                HorizonViewClient-Konfigurationsvorlage:Sicherheitseinstellungen(Fortsetzung)EinstellungBeschreibungConfiguresSSLprotocolsandcryptographicalgorithms(EinstellungfürdieComputer-undBenutzerkonfiguration)KonfiguriertdieVerschlüsselungsliste,umdieVerwendungbestimmterkrypto-grafischerAlgorithmenundProtokollezubeschrnken,bevorSieeinever-schlüsselteSSL-Verbindungherstellen.
                DieVerschlüsselungslistebestehtausei-nerodermehrerenVerschlüsselungszeichenfolgen,diedurchDoppelpunktevoneinandergetrenntwerden.
                HINWEISFüralleVerschlüsselungszeichenfolgenwirddieGro-/Kleinschrei-bungberücksichtigt.
                WenndieseFunktionaktiviertist,lautetderStandardwertSSLv3:TLSv1:TLSv1.
                1:AES:!
                aNULL:@STRENGTH.
                Diesbedeutet,dassSSLv3.
                0,TLSv1.
                0undTLSv1.
                1aktiviertsind.
                (SSLv2.
                0undTLSv1.
                2sinddeaktiviert.
                )Verschlüsselungssammlungenverwenden128-oder256-Bit-AES,entfernenanonymeDH-AlgorithmenundsortierenanschlieenddieaktuelleVerschlüsse-lungslistenachderSchlüssellngedesVerschlüsselungsalgorithmus.
                Referenz-LinkfürdieKonfiguration:http://www.
                openssl.
                org/docs/apps/ciphers.
                htmlEnableSingleSign-Onforsmartcardauthentication(EinstellungfürdieComputerkonfi-guration)Legtfest,obfürdieSmartcard-AuthentifizierungdasSingleSign-On(SSO)akti-viertist.
                IstSSOaktiviert,speichertHorizonViewClientdieverschlüsselteSmartcard-PINimtemporrenArbeitsspeicher,bevorsieandenView-Verbin-dungsservergesendetwird.
                IstSSOdeaktiviert,zeigtHorizonViewClientkeinbenutzerdefiniertesPIN-Dialogfeldan.
                IgnorebadSSLcertificatedatereceivedfromtheserver(EinstellungfürdieComputerkonfi-guration)(NurView4.
                6undfrühereVersionen)Legtfest,obFehlerinZusammenhangmitungültigenDatumswertenfürdasServerzertifikatignoriertwerden.
                DieseFehlertretenauf,wenneinServereinabgelaufenesZertifikatsendet.
                Ignorecertificaterevocationproblems(EinstellungfürdieComputerkonfi-guration)(NurView4.
                6undfrühereVersionen)Legtfest,obFehlerinZusammenhangmiteinemgesperrtenServerzertifikatignoriertwerden.
                DieseFehlertretenauf,wennderServereinZertifikatsendet,dasgesperrtwurde,undderClientdenSperrstatuseinesZertifikatsnichtüberprüfenkann.
                DieseEinstellungiststandardmigdeaktiviert.
                IgnoreincorrectSSLcertifi-catecommonname(hostnamefield)(EinstellungfürdieComputerkonfi-guration)(NurView4.
                6undfrühereVersionen)Legtfest,obFehlerinZusammenhangmitfalschenallgemeinenNamenimServerzertifikatignoriertwerden.
                DieseFehlertretenauf,wennderallgemeineNamedesZertifikatsnichtmitdemHostnamendesServersübereinstimmt,derdasZertifikatsendet.
                Ignoreincorrectusageprob-lems(EinstellungfürdieComputerkonfi-guration)(NurView4.
                6undfrühereVersionen)Legtfest,obFehlerinZusammenhangmiteinerfalschenVerwendungdesServerzertifikatsignoriertwerden.
                DieseFehlertretenauf,wenndasvomServergesendeteZertifikatfüreinenanderenZweckalsdieberprüfungderAbsenderidentittundzumVerschlüsselnderServerkommunikationgedachtist.
                Ignoreunknowncertificateau-thorityproblems(EinstellungfürdieComputerkonfi-guration)(NurView4.
                6undfrühereVersionen)Legtfest,obbestimmteFehlerinZusam-menhangmiteinerunbekanntenZertifizierungsstelleimServerzertifikatigno-riertwerden.
                DieseFehlertretenauf,wenndasvomServergesendeteZertifikatdurcheinenichtvertrauenswürdigeDrittanbieter-Zertifizierungsstellesigniertwurde.
                RDP-EinstellungenfürClient-GPOsSieknnenGruppenrichtlinienfürOptionenwiedieUmleitungvonAudio,Druckern,PortsundanderenGertenfestlegen,wennSiedasMicrosoftRDP-Anzeigeprotokollverwenden.
                InderfolgendenTabellewerdendieinderADM-VorlagendateifürdieHorizonViewClient-KonfigurationenthaltenenRDP-Einstellungen(RemoteDesktopProtocol)beschrieben.
                AlleRDP-EinstellungensindEin-stellungenfürdieBenutzerkonfiguration.
                VerwendungvonVMwareViewHorizonClientfürWindows42VMware,Inc.
                Tabelle36.
                ADM-VorlagefürHorizonViewClient-Konfiguration:RDP-EinstellungenEinstellungBeschreibungAudioredirectionLegtfest,obaufdemRemote-DesktopwiedergegebeneAudioinformationenum-geleitetwerden.
                EsstehenfolgendeEinstellungenzurAuswahl:nDisableAudio:DieAudiowiedergabeistdeaktiviert.
                nPlayVM(erforderlichfürVoIPUSB-Unterstützung):AudiodatenwerdenimRemote-Desktopwiedergegeben.
                DieseEinstellungerforderteingemeinsamgenutztesUSB-AudiogertzurWiedergabevonSoundaufdemClient.
                nRedirecttoclient:AudiodatenwerdenandenClientumgeleitet.
                DiesistderStandardmodus.
                DieseEigenschaftgiltnurfürRDP-Audio.
                berMMRumgeleiteteAudiodatenwerdenimClientwiedergegeben.
                AudiocaptureredirectionLegtfest,obdasstandardmigeAudioeingabegertvomClientandieRemote-Sitzungumgeleitetwird.
                WenndieseEinstellungaktiviertist,wirddasAudioauf-zeichnungsgertdesClientsimRemote-DesktopangezeigtundkannzurAufzeich-nungvonAudioeingabedatenverwendetwerden.
                DieseEinstellungiststandardmigdeaktiviert.
                BitmapcachefilesizeinunitfornumberbppbitmapsGibtdieGredesBitmapcaches(inKBoderMB)fürdieZwischenspeicherungvonBitmapsmiteinerbestimmtenFarbeinstellung(BitsproPixel,bpp)an.
                FürdieverschiedenenKombinationenausEinheitundBitsproPixelstehenunter-schiedlicheVersionenzurVerfügung:nKB/8bppnMB/8bppnMB/16bppnMB/24bppnMB/32bppBitmapcaching/cachepersis-tenceactive(Bitmap-Ca-che/DauerhafteZwischenspei-cherungaktiv)Legtfest,obfürBitmapseinedauerhafteZwischenspeicherungdurchgeführtwird(aktivist).
                EinedauerhafteZwischenspeicherungfürBitmapskanndieLeistungverbessern,erfordertjedochzustzlichenSpeicherplatz.
                ColorDepthLegtdieFarbtiefefürdenRemote-Desktopfest.
                EsstehenfolgendeEinstellungenzurAuswahl:n8Bitn15Bitn16Bitn24Bitn32BitFürWindowsXP-Systememit24BitmüssenSiedieRichtlinieLimitMaximumColorDepthinComputerConfiguration>AdministrativeTemplates>Wind-owsComponents>TerminalServicesaktivierenundauf24Bitfestlegen.
                CursorshadowLegtfest,obaufdemRemote-DesktopunterdemCursoreinSchattenangezeigtwird.
                DesktopBackgroundLegtfest,obderDesktop-Hintergrundangezeigtwird,wennClientseineVerbin-dungzueinemRemote-Desktopherstellen.
                Desktopcomposition(WindowsVistaoderhher)Legtfest,obdieDesktop-GestaltungaufdemRemote-Desktopaktiviertist.
                WenndieDesktop-Gestaltungaktiviertist,werdeneinzelneFensternichtlngerdirektaufdemBildschirmoderdemprimrenAnzeigegertdargestellt,wiediesinfrüherenVersionenvonMicrosoftWindowsderFallwar.
                StattdessenwerdendieBilddatenzunchstindennichtsichtbarenOffscreen-BereichdesVideospeichersumgeleitetundanschlieendzurDarstellungaufdemAnzeigegertineinDesk-top-Bildgerendert.
                EnablecompressionLegtfest,obRDP-Datenkomprimiertwerden.
                DieseEinstellungiststandardmigaktiviert.
                Kapitel3KonfigurierenvonHorizonViewClientfürEndbenutzerVMware,Inc.
                43Tabelle36.
                ADM-VorlagefürHorizonViewClient-Konfiguration:RDP-Einstellungen(Fortsetzung)EinstellungBeschreibungEnableCredentialSecurityServiceProviderGibtan,obdieRemote-Desktop-VerbindungdieAuthentifizierungaufNetzwerk-ebene(NetworkLevelAuthentication,NLA)verwendet.
                InWindowsVistaerfor-dernRemote-Desktop-VerbindungenstandardmigNLA.
                WenndasGastbetriebssystemfürRemote-Desktop-VerbindungenNLAerfordert,müssenSiedieseEinstellungaktivieren.
                AndernfallskannHorizonViewClientkeineVerbindungzumDesktopherstellen.
                ZustzlichzurAktivierungdieserEinstellungmüssenSiesicherstellen,dassdiefolgendenBedingungenerfülltsind:nSowohldasClient-alsauchdasGastbetriebssystemunterstützenNLA.
                nFürdieView-Verbindungsserver-InstanzsinddirekteClientverbindungenak-tiviert.
                TunnelverbindungenwerdenmitNLAnichtunterstützt.
                EnableRDPAuto-ReconnectLegtfest,obdieRDP-Clientkomponenteversucht,erneuteineVerbindungmitei-nemRemote-Desktopherzustellen,nachdemeinRDP-Verbindungsfehleraufgetre-tenist.
                DieseEinstellunghatkeineAuswirkung,wenndieOptionUsesecuretun-nelconnectiontodesktop(SichereTunnelverbindungzumDesktopverwenden)inViewAdministratoraktiviertwurde.
                DieseEinstellungiststandardmigdeak-tiviert.
                HINWEISDieautomatischeerneuteRDP-VerbindungwirdfürDesktopsmitViewAgent4.
                5odereinerhherenVersionunterstützt.
                WenneinDesktopeinefrühereVersionvonViewAgentverwendet,knneneinigeFunktionennichtverwendetwerden.
                Fontsmoothing(WindowsVistaoderhher)Legtfest,obAnti-AliasingaufdieSchriftartenaufdemRemote-Desktopangewendetwird.
                MenuandwindowanimationLegtfest,obdieAnimationfürMenüsundFensteraktiviertist,wennClientseineVerbindungzueinemRemote-Desktopherstellen.
                RedirectclipboardLegtfest,obdieInformationeninderlokalenZwischenablageumgeleitetwerden,wennClientseineVerbindungzumRemote-Desktopherstellen.
                RedirectdrivesLegtfest,oblokaleFestplattenlaufwerkeumgeleitetwerden,wennClientseineVerbindungzumRemote-Desktopherstellen.
                LokaleLaufwerkewerdenstandard-migumgeleitet.
                DurchAktivierenoderNichtkonfigurierendieserEinstellungknnenDatenaufdemumgeleitetenLaufwerkdesRemote-DesktopsaufdasLaufwerkdesClient-computerskopiertwerden.
                DeaktivierenSiedieseEinstellung,wenndasbertra-genvonDatenvomRemote-DesktopzudenClientcomputerndesBenutzerseinmglichesSicherheitsrisikofürIhreBereitstellungdarstellt.
                AlternativknnenSieauchdieOrdnerumleitungindervirtuellenMaschinedesRemote-Desktopsdeak-tivieren,indemSiedieMicrosoftWindows-GruppenrichtlinieneinstellungDonotallowdriveredirection(Laufwerkumleitungnichtzulassen)aktivie-ren.
                DieEinstellungRedirectdrives(Laufwerkeumleiten)wirktsichnuraufRDPaus.
                RedirectprintersLegtfest,oblokaleDruckerumgeleitetwerden,wennClientseineVerbindungzumRemote-Desktopherstellen.
                RedirectserialportsLegtfest,oblokaleCOM-Portsumgeleitetwerden,wennClientseineVerbindungzumRemote-Desktopherstellen.
                RedirectsmartcardsLegtfest,oblokaleSmartcardsumgeleitetwerden,wennClientseineVerbindungzumRemote-Desktopherstellen.
                HINWEISDieseEinstellunggiltsowohlfürRDP-alsauchfürPCoIP-Verbindungen.
                Redirectsupportedplug-and-playdevicesLegtfest,oblokalePlug&Play-sowiePOS-Gerte(PointofSale)umgeleitetwer-den,wennClientseineVerbindungzumRemote-Desktopherstellen.
                DiesesVer-haltenunterscheidetsichdahingehendvonderUmleitung,dassesdurchdieHorizonViewAgent-KomponentefürdieUSB-Umleitungverwaltetwird.
                ShadowbitmapsLegtfest,obSchattenbitmapsverwendetwerden.
                DieseEinstellunghatimVoll-bildmoduskeineAuswirkung.
                VerwendungvonVMwareViewHorizonClientfürWindows44VMware,Inc.
                Tabelle36.
                ADM-VorlagefürHorizonViewClient-Konfiguration:RDP-Einstellungen(Fortsetzung)EinstellungBeschreibungShowcontentsofwindowwhi-ledraggingLegtfest,obOrdnerinhalteangezeigtwerden,wennderBenutzereinenOrdneraneinenneuenSpeicherortzieht.
                ThemesLegtfest,obDesignsangezeigtwerden,wennClientseineVerbindungzueinemRemote-Desktopherstellen.
                Windowskeycombinationre-directionLegtfest,woWindows-Tastenkombinationenangewendetwerden.
                MitdieserEinstellungknnenSieTastenkombinationenandievirtuelleRemote-MaschinesendenoderlokalTastenkombinationenanwenden.
                WenndieseEinstellungnichtkonfiguriertist,werdenTastenkombinationenlokalangewandt.
                AllgemeineEinstellungenfürClient-GPOsZudenEinstellungenzhlenProxy-Optionen,Zeitzonenweiterleitung,MultimediabeschleunigungundsonstigeAnzeigeeinstellungen.
                AllgemeineEinstellungenInderfolgendenTabellewerdendieinderADM-VorlagendateifürdieHorizonViewClient-KonfigurationenthaltenenallgemeinenEinstellungenbeschrieben.
                ZudenallgemeinenEinstellungengehrensowohlEin-stellungenfürdieComputerkonfigurationalsauchEinstellungenfürdieBenutzerkonfiguration.
                DieEin-stellungfürdieBenutzerkonfigurationsetzthierbeidiequivalenteEinstellungfürdieComputerkonfigura-tionauerKraft.
                Tabelle37.
                HorizonViewClient-Konfigurationsvorlage:AllgemeineEinstellungenEinstellungBeschreibungAlwaysontop(EinstellungfürdieBenutzerkonfi-guration)Legtfest,obdasHorizonViewClient-FensterimmerimVordergrundangezeigtwird.
                DurchAktivierungdieserEinstellungwirdverhindert,dassdieWindows-TaskleisteeinHorizonViewClient-FensterimVollbildmodusüberlappt.
                DieseEinstellungiststandardmigaktiviert.
                DeterminesiftheVMwareViewClientshoulduseproxy.
                pacfile(EinstellungfürdieComputerkonfi-guration)(NurView4.
                6undfrühereVersionen)Legtfest,obHorizonViewClienteinePAC-Datei(ProxyAutomaticConfiguration)verwendet.
                WenndieseEinstellungaktiviertist,verwendetHorizonViewClienteinePAC-Datei.
                EinePAC-Datei(hufigalsproxy.
                pacbezeichnet)hilftWebbrowsernundande-renAgenten,dengeeignetenProxy-ServerfüreinebestimmteURLoderWebsite-Anforderungzufinden.
                WennSiedieseEinstellungaufeinerMaschinemitmehrerenKernenaktivieren,stürztmglicherweisedieWinINet-Anwendungab,dieHorizonViewClientfürdieSuchenachProxy-Server-Informationenverwendet.
                DeaktivierenSiedieseEinstellung,wenndiesesProblemaufIhrerMaschineauftritt.
                DieseEinstellungiststandardmigdeaktiviert.
                HINWEISDieseEinstellunggiltnurfürdirekteVerbindungen.
                AufTunnelverbin-dungenhatdieEinstellungkeineAuswirkung.
                DisableTimeZoneForwarding(EinstellungfürdieComputerkonfi-guration)Legtfest,obdieZeitzonensynchronisierungdesRemote-DesktopsmitderdesverbundenenClientsdeaktiviertist.
                Disabletoastnotifications(Toastnachrichtendeaktivie-ren)(EinstellungfürdieComputer-undBenutzerkonfiguration)Hierdurchwirdfestgelegt,obToastnachrichtenvonHorizonViewClientdeakti-viertwerdensollen.
                AktivierenSiedieseEinstellung,wennSienichtmchten,dassdemBenutzerToastnachrichteninderEckedesBildschirmsangezeigtwerden.
                HINWEISWennSiedieseEinstellungaktivieren,wirddemBenutzerbeiAktivie-rungderFunktionSitzungszeitüberschreitung"keine5-Minuten-Warnungein-geblendet.
                Kapitel3KonfigurierenvonHorizonViewClientfürEndbenutzerVMware,Inc.
                45Tabelle37.
                HorizonViewClient-Konfigurationsvorlage:AllgemeineEinstellungen(Fortsetzung)EinstellungBeschreibungDon'tcheckmonitoralignmentonspanning(EinstellungfürdieBenutzerkonfi-guration)StandardmigwirdderClient-DesktopnichtindenMehrfachmonitor-Modusgeschaltet,wenndieBildschirmeinKombinationkeinexaktesRechteckbilden(d.
                h.
                identischeHhebeihorizontalerAnordnungoderidentischeBreitebeiverti-kalerAnordnung).
                AktivierenSiedieseEinstellung,umdenStandardwertauerKraftzusetzen.
                DieseEinstellungiststandardmigdeaktiviert.
                Enablemulti-mediaaccelera-tion(EinstellungfürdieBenutzerkonfi-guration)Legtfest,obdieMultimedia-Umleitung(MultimediaRedirection,MMR)aufdemClientaktiviertist.
                MMRarbeitetnichtordnungsgem,wenndieHorizonViewClient-HardwarezurVideoanzeigekeineOverlay-Unterstützungbietet.
                RelativeMausaktivieren(EinstellungfürdieComputer-undBenutzerkonfiguration)(NurHorizonView5.
                2undhhereVersionen)AktiviertdierelativeMausbeiVerwendungdesPCoIP-Anzeigeprotokolls.
                DerModusfürrelativeMausopti-miertdasMausverhaltenfürbestimmteGrafikanwendungenundSpiele.
                FallsderModusfürrelativeMausnichtvomRemote-Desktopunterstütztwird,wirddieseEinstellungnichtverwendet.
                DieseEinstellungiststandardmigdeaktiviert.
                Enabletheshade(EinstellungfürdieBenutzerkonfi-guration)Legtfest,obdieSchatten-MenüleisteimoberenBereichdesHorizonViewClient-Fensterssichtbarist.
                DieseEinstellungiststandardmigaktiviert.
                HINWEISDieSchatten-MenüleisteimoberenBereichistfürdenKiosk-Modusstandardmigdeaktiviert.
                Tunnelproxybypassaddresslist(EinstellungfürdieComputerkonfi-guration)GibteineListevonTunneladressenan.
                DerProxy-ServerwirdfürdieseAdressennichtverwendet.
                VerwendenSieeinSemikolon(;)zumTrennenmehrererEintr-ge.
                URLforViewClientonlinehelp(EinstellungfürdieComputerkonfi-guration)GibteinealternativeURLan,vonderHorizonViewClientHilfeseitenabrufenkann.
                DieseEinstellungistzurVerwendunginUmgebungengedacht,diedasre-moteverwalteteHilfesystemnichtabrufenknnen,dakeinInternetzugriffver-fügbarist.
                PintheShade(EinstellungfürdieBenutzerkonfi-guration)Legtfest,obdieFixierungderMenüleisteimoberenBereichdesHorizonViewClient-Fenstersaktiviertist,sodassdieMenüleistenichtautoma-tischausgeblendetwird.
                DieseEinstellunghatkeineAuswirkung,wenndieMe-nüleistedeaktiviertwurde.
                DieseEinstellungiststandardmigaktiviert.
                MeldungenzumTrennenvonDesktopsdeaktivieren(EinstellungfürdieComputer-undBenutzerkonfiguration)Legtfest,obMeldungen,dienormalerweisebeimTrennenvonDesktopsange-zeigtwerden,deaktiviertwerdensollen.
                DieseMeldungenwerdenstandardm-igangezeigt.
                USB-EinstellungenfürClient-GPOsSieknnenUSB-RichtlinieneinstellungensowohlfürHorizonViewAgentalsauchfürHorizonViewClientfürWindowsdefinieren.
                NachdemHerstellenderVerbindungldtHorizonViewClientdieUSB-Richtlini-eneinstellungenvonHorizonViewAgentherunterundverwendetdiesezusammenmitdenHorizonViewClient-USB-Richtlinieneinstellungen,umzuentscheiden,welcheGertevomHostcomputerumgeleitetwerdendürfen.
                InderfolgendenTabellewerdendieRichtlinieneinstellungenzumSplittenvonUSB-VerbundgerteninderADM-VorlagendateifürdieHorizonViewClient-Konfigurationbeschrieben.
                DieEinstellungengeltenaufComputerebene.
                HorizonViewClientliestdieEinstellungenvorzugsweiseausdemGPOaufderCompu-terebene,andernfallsausderRegistrierungunterHKLM\Software\Policies\VMware,Inc.
                \VMwareVDM\Cli-ent\USB.
                EineBeschreibung,wieHorizonViewdieRichtlinienzumSplittenvonUSB-Verbundgertenanw-endet,findenSieindenThemenüberdieVerwendungvonRichtlinienzurSteuerungderUSB-UmleitungimDokumentVerwaltungvonVMwareHorizonView‐.
                VerwendungvonVMwareViewHorizonClientfürWindows46VMware,Inc.
                Tabelle38.
                HorizonViewClient-Konfigurationsvorlage:USB-SplittingeinstellungenEinstellungEigenschaftenAutom.
                GertesplittenzulassenLsstdasautomatischeSplittenvonCompositeUSB-Gertenzu.
                DerStandardwertistnichtdefiniert,wasgleichbedeutendmitfalseist.
                ExcludeVid/PidDeviceFromSplit(Vid/Pid-GertvomSplittenausschlieen)SchlieteinCompositeUSB-GertvomSplittenaus,dasdurchAnbieter-undProdukt-IDsangegebenist.
                DasFormatderEinstellunglautetvid-xxx1_pid-yyy2[;vid-xxx2_pid-yyy2].
                .
                .
                SiemüssenhexadezimaleID-Nummernangeben.
                SieknnendasPlatzhalterzeichen(*)anstelleeinzelnerZiffernineinerIDverwenden.
                Beispiel:vid-0781_pid-55**DerStandardwertistnichtdefiniert.
                SplitVid/PidDevice(Vid/Pid-Gertsplit-ten)BehandeltdieKomponenteneinesCompositeUSB-Gertes,diedurchAnbieter-undPro-dukt-IDsangegebensind,alsseparateGerte.
                DasFormatderEinstellungistvid-xxxx_pid-yyyy(exintf:zz[;exintf:ww])SieknnendasStichwortexintfverwenden,umKomponentendurchAngabeihrerSchnittstellennummervonderUmleitungauszuschlieen.
                SiemüssenhexadezimaleID-NummernunddezimaleSchnittstellennummerneinschlielichder0amAnfangangeben.
                SieknnendasPlatzhalterzeichen(*)anstelleeinzelnerZiffernineinerIDverwenden.
                Beispiel:vid-0781_pid-554c(exintf:01;exintf:02)HINWEISHorizonViewschlietnichtautomatischdieKomponentenein,dieSienichtex-plizitausgeschlossenhaben.
                SiemüsseneineFilterrichtliniewiez.
                B.
                IncludeVid/PidDevice(Vid/Pid-Gerteinschlieen)angeben,umdieseKomponenteneinzuschlie-en.
                DerStandardwertistnichtdefiniert.
                InderfolgendenTabellewerdendieRichtlinieneinstellungenzumFilternvonUSB-VerbundgerteninderADM-VorlagendateifürdieHorizonViewClient-Konfigurationbeschrieben.
                DieEinstellungengeltenaufComputerebene.
                HorizonViewClientliestdieEinstellungenvorzugsweiseausdemGPOaufderCompu-terebene,andernfallsausderRegistrierungunterHKLM\Software\Policies\VMware,Inc.
                \VMwareVDM\Cli-ent\USB.
                EineBeschreibung,wieHorizonViewdieRichtlinienzumFilternvonUSB-Gertenanwendet,fin-denSieindenThemenüberdieKonfigurationvonFilterrichtlinieneinstellungenfürdieUSB-UmleitungimDokumentVerwaltungvonVMwareHorizonView‐.
                Tabelle39.
                HorizonViewClient-Konfigurationsvorlage:USB-FiltereinstellungenEinstellungEigenschaftenAllowAudioInputDe-vices(Audioeingabege-rtezulassen)Lsstzu,dassAudioeingabegerteumgeleitetwerden.
                DerStandardwertistnichtdefiniert,wasgleichbedeutendmittrueist.
                AllowAudioOutputDe-vices(Audioausgabege-rtezulassen)Lsstzu,dassAudioausgabegerteumgeleitetwerden.
                DerStandardwertistnichtdefiniert,wasgleichbedeutendmitfalseist.
                AllowHIDBootable(HIDBootablezulassen)ErmglichtdieUmleitungandererEingabegertenebenTastaturenundMusen,diezurStartzeitverfügbarsind(auchbezeichnetalsstartfhigeEingabegerte").
                DerStandardwertistnichtdefiniert,wasgleichbedeutendmittrueist.
                Verhaltenauchdannzulassen,wennGerte-beschreibungennichtabgerufenwerdenkn-nenErmglichtdieUmleitungderGerte,auchwennHorizonViewClientdieKonfigurati-ons-/Gertebeschreibungennichtabrufenkann.
                UmeinGerttrotzFehlerinderKonfiguration/Beschreibungzuzulassen,mussdiesesindenFilterInclude"eingeschlossenwerden,zumBeispielinIncludeVidPidoderInclu-dePath.
                DerStandardwertistnichtdefiniert,wasgleichbedeutendmitfalseist.
                AndereEingabegertezulassenLsstzu,dassEingabegerteauerHID-startfhigenGertenoderTastaturenmitinteg-riertenZeigegertenumgeleitetwerden.
                DerStandardwertistnichtdefiniert,wasgleichbedeutendmittrueist.
                Kapitel3KonfigurierenvonHorizonViewClientfürEndbenutzerVMware,Inc.
                47Tabelle39.
                HorizonViewClient-Konfigurationsvorlage:USB-Filtereinstellungen(Fortsetzung)EinstellungEigenschaftenAllowKeyboardandMouseDevices(Tasta-tur-undMausgertezulassen)Lsstzu,dassTastaturenmiteingebautenZeigegerten(Maus,TrackballoderTouchpad)umgeleitetwerden.
                DerStandardwertistnichtdefiniert,wasgleichbedeutendmitfalseist.
                AllowSmartCards(SmartCardszulassen)Lsstzu,dassSmartCard-Gerteumgeleitetwerden.
                DerStandardwertistnichtdefiniert,wasgleichbedeutendmitfalseist.
                AllowVideoDevices(Videogertezulassen)Lsstzu,dassVideogerteumgeleitetwerden.
                DerStandardwertistnichtdefiniert,wasgleichbedeutendmittrueist.
                Remote-KonfigurationdeaktivierenDeaktiviertdieVerwendungderViewAgent-EinstellungenbeimDurchführenderUSB-Gertefilterung.
                DerStandardwertistnichtdefiniert,wasgleichbedeutendmitfalseist.
                ExcludeAllDevices(AlleGerteaus-schlieen)SchlietalleUSB-GertevonderUmleitungaus.
                WennfürdieseEinstellungtruefestge-legtist,knnenSieandereRichtlinieneinstellungenverwenden,umzuzulassen,dassbe-stimmteGerteoderGertefamilienumgeleitetwerden.
                WennfürdieseEinstellungfalsefestgelegtist,knnenSieandereRichtlinieneinstellungenverwenden,umzuverhindern,dassbestimmteGerteoderGertefamilienumgeleitetwerden.
                WennSiedenWertvonExcludeAllDevicesinViewAgentauftruesetzenunddieseEinstellunganHorizonViewClientweitergegebenwird,überschreibtdieViewAgent-EinstellungdieHorizonViewClient-Einstellung.
                DerStandardwertistnichtdefiniert,wasgleichbedeutendmitfalseist.
                ExcludeDeviceFamily(Gertefamilieaus-schlieen)SchlietGertefamilienvonderUmleitungaus.
                DasFormatderEinstellungistFamilienna‐me_1[;Familienname_2].
                .
                .
                Beispiel:bluetooth;smart-cardWennSiedasautomatischeGertesplittenaktivierthaben,prüftHorizonViewdieGerte-familiejederSchnittstelleeinesUSB-Verbundgerts,umzuentscheiden,welcheSchnitt-stellenausgeschlossenwerdensollten.
                WennSiedasautomatischeGertesplittendeakti-vierthaben,prüftHorizonViewdieGertefamiliedesgesamtenUSB-Verbundgerts.
                DerStandardwertistnichtdefiniert.
                ExcludeVid/PidDevice(Vid/Pid-Gertaus-schlieen)SchlietGertemiteinerangegebenenAnbieter-oderProdukt-IDvonderUmleitungaus.
                DasFormatderEinstellunglautetvid-xxx1_pid-yyy2[;vid-xxx2_pid-yyy2].
                .
                .
                SiemüssenhexadezimaleID-Nummernangeben.
                SieknnendasPlatzhalterzeichen(*)anstelleeinzelnerZiffernineinerIDverwenden.
                Beispiel:vid-0781_pid-****;vid-0561_pid-554cDerStandardwertistnichtdefiniert.
                ExcludePath(Pfadausschlieen)SchlietGerteanangegebenenHub-oderPortpfadenvonderUmleitungaus.
                DasFor-matderEinstellungistbus-x1[/y1].
                .
                .
                /port-z1[;bus-x2[/y2].
                .
                .
                /port-z2].
                .
                .
                Bus-undPortnummernmüssenimhexadezimalenFormatangegebenwerden.
                SieknnendasPlatzhalterzeichennichtinPfadenverwenden.
                Beispiel:bus-1/2/3_port-02;bus-1/1/1/4_port-ffDerStandardwertistnichtdefiniert.
                IncludeDeviceFamily(Gertefamilieein-schlieen)BestimmtGertefamilien,dieumgeleitetwerdenknnen.
                DasFormatderEinstellungistFamilienname_1[;Familienname_2].
                .
                .
                Beispiel:SpeicherDerStandardwertistnichtdefiniert.
                VerwendungvonVMwareViewHorizonClientfürWindows48VMware,Inc.
                Tabelle39.
                HorizonViewClient-Konfigurationsvorlage:USB-Filtereinstellungen(Fortsetzung)EinstellungEigenschaftenIncludePath(Pfadeinschlieen)SchlietGerteanangegebenenHub-oderPortpfadenindieUmleitungein.
                DasFormatderEinstellungistbus-x1[/y1].
                .
                .
                /port-z1[;bus-x2[/y2].
                .
                .
                /port-z2].
                .
                .
                Bus-undPortnummernmüssenimhexadezimalenFormatangegebenwerden.
                SieknnendasPlatzhalterzeichennichtinPfadenverwenden.
                Beispiel:bus-1/2_port-02;bus-1/7/1/4_port-0fDerStandardwertistnichtdefiniert.
                IncludeVid/PidDevice(Vid/Pid-Gertein-schlieen)BestimmtGertemiteinerangegebenenAnbieter-undProdukt-ID,dieumgeleitetwerdenknnen.
                DasFormatderEinstellunglautetvid-xxx1_pid-yyy2[;vid-xxx2_pid-yyy2].
                .
                .
                SiemüssenhexadezimaleID-Nummernangeben.
                SieknnendasPlatzhalterzeichen(*)anstelleeinzelnerZiffernineinerIDverwenden.
                Beispiel:vid-0561_pid-554cDerStandardwertistnichtdefiniert.
                AusführenvonViewClientausderBefehlszeileSieknnenViewClientfürWindowsvonderBefehlszeileausoderüberSkriptsausführen.
                Dieskanner-wünschtsein,wennSieeinekioskbasierteAnwendungimplementieren,dieEndbenutzernZugriffaufDesktop-Anwendungengewhrt.
                SieverwendendenBefehlvmware-view.
                exe,umViewClientfürWindowsvonderBefehlszeileauszufüh-ren.
                DerBefehlumfasstOptionen,dieSieangebenknnen,umdasVerhaltenvonViewClientzundern.
                VerwendenvonHorizonViewClient-BefehlenDieSyntaxdesBefehlsvmware-viewlegtfest,wieHorizonViewClientausgeführtwird.
                VerwendenSiedenBefehlvmware-viewaneinerWindows-EingabeaufforderungmitdemfolgendenFormat.
                vmware-view[command_line_option[argument]].
                .
                .
                DerStandardpfadzurausführbarenDateidesBefehlsvmware-viewistvomSystemabhngig.
                nAuf32-Bit-SystemenlautetderPfadC:\Programme\VMware\VMwareHorizonViewClient\.
                nAuf64-Bit-SystemenlautetderPfadC:\Programme(x86)\VMware\VMwareHorizonViewClient\.
                ZurVereinfachungfügenSiediesenPfadzuIhrerUmgebungsvariablePATHhinzu.
                InderfolgendenTabellesinddieBefehlszeilenoptionenaufgeführt,diemitdemBefehlvmware-viewver-wendetwerdenknnen.
                Tabelle310.
                HorizonViewClient-BefehlszeilenoptionenOptionBeschreibung/ZeigtdieListederBefehlsoptionenan.
                -connectUSBOnStartupWennhiertrueangegebenist,werdenallegegenwrtigmitdemHostver-bundenenUSB-GerteandenDesktopumgeleitet.
                DieseOptionwirdbeiAn-gabederOption-unattendedimplizitfestgelegt.
                DieStandardeinstellungistfalse.
                -connectUSBOnInsertWennhiertrueangegebenist,wirdeinUSB-GertmitdemDesktopimVor-dergrundverbunden,wennSiedasGertanschlieen.
                DieseOptionwirdbeiAngabederOption-unattendedimplizitfestgelegt.
                DieStandardeinstellungistfalse.
                Kapitel3KonfigurierenvonHorizonViewClientfürEndbenutzerVMware,Inc.
                49Tabelle310.
                HorizonViewClient-Befehlszeilenoptionen(Fortsetzung)OptionBeschreibung-desktopLayoutFenstergreGibtan,wiedasDesktop-Fensterangezeigtwird:fullscreenAnzeigeimVollbildmodusmultimonitorAnzeigeaufmehrerenMonitorenwindowLargeGroesFensterwindowSmallKleinesFenster-desktopNameDesktop‐NameGibtdenNamendesDesktopsan,derimDialogfeldzurDesktop-Auswahlangezeigtwird.
                DiesistderAnzeigenamedesDesktopsimDialogfeldzurDesktop-Auswahl.
                -desktopProtocolProtokollGibtdenNamendeszuverwendendenProtokollsan,derimDialogfeldzurDesktop-Auswahlangezeigtwird.
                DasProtokollkannPCOIPoderRDPsein.
                -domainNameDomnennameGibtdieDomnean,diederEndbenutzerzurAnmeldunganHorizonViewClientverwendet.
                -fileDateipfadGibtdenPfadeinerKonfigurationsdateimitzustzlichenBefehlsoptionenund-argumentenan.
                SieheViewClient-Konfigurationsdatei",aufSeite51.
                -hZeigtHilfeoptionenan.
                -languageIdGebietsschema‐IDBietetLokalisierungsunterstützungfürverschiedeneSpracheninHorizonViewClient.
                WenneineRessourcenbibliothekverfügbarist,gebenSiediezuverwendendeGebietsschema-ID(LocaleID,LCID)an.
                FürEnglisch(USA)gebenSie0x409ein.
                -logInAsCurrentUserWennhiertrueangegebenist,werdendieAnmeldeinformationendesEnd-benutzers,diedieserzurAnmeldungamClientsystemeingegebenhat,andieView-Verbindungsserver-InstanzundschlielichandenView-Desktopüber-geben.
                DieStandardeinstellungistfalse.
                -nonInteractiveUnterdrücktFehlermeldungenbeimStartenvonHorizonViewClientübereinSkript.
                DieseOptionwirdbeiAngabederOption-unattendedimplizitfestgelegt.
                -noVMwareAddinsVerhindertdasLadenvonVMware-spezifischenvirtuellenKanlen,wiez.
                B.
                fürdenvirtuellenDruck.
                -passwordKennwortGibtdasKennwortan,dasderEndbenutzerzurAnmeldunganHorizonViewClientverwendet.
                DieseOptionmussfürClientsimKiosk-Mo-dusnichtangegebenwerden,wenndasKennwortautomatischgeneriertwird.
                -printEnvironmentInfoZeigtdieIP-Adresse,dieMAC-AdresseunddenMaschinennamendesClientgertsan.
                -serverURLVerbindungsserverGibtdieURL,dieIP-AdresseoderdenFQDNderView-Verbindungsserver-Instanzan.
                -SingleAutoConnect(HorizonViewClient2.
                3oderhher)WenneinBenutzernurAnspruchaufeinenRemote-Desktophat,wirdmitdieserEinstellungnachderAuthentifi-zierungdesBenutzersbeimServerautomatischeineVerbindungmitdemDesktophergestelltundderBenutzerwirdangemeldet.
                DemBenutzerwirddadurchdieAuswahldesDesktopsauseinerListemitnureinemDesktoperspart.
                -smartCardPINPINGibtdiePINan,wenneinEndbenutzereineSmartcardzurAnmeldungein-führt.
                VerwendungvonVMwareViewHorizonClientfürWindows50VMware,Inc.
                Tabelle310.
                HorizonViewClient-Befehlszeilenoptionen(Fortsetzung)OptionBeschreibung-standaloneUnterstütztzurBereitstellungvonAbwrtskompatibilitt.
                DiesistdasStan-dardverhaltenfürdiesenClient.
                DieAngabevon-standaloneistnichterfor-derlich.
                StarteteinezweiteInstanzvonHorizonViewClient,dieeineVerbin-dungmitdemselbenodereinemanderenView-Verbindungsserverherstellenkann.
                FürmehrereDesktopverbindungenzumselbenodereinemanderenServerwirdkeinesichereTunnelverbindungunterstützt.
                HINWEISDiezweiteDesktopverbindunghatmglicherweisekeinenZugriffaufdielokaleHardware,wieUSB-Gerte,Smartcards,DruckerundmehrereMonitore.
                -unattendedFührtHorizonViewClientimnichtinteraktivenModusaus,dersichfürClientsimKiosk-Moduseignet.
                ZustzlichmüssenfolgendeInformationenangegebenwerden:nDerKontonamedesClients,wenndiesernichtüberdieMAC-AdressedesClientgertsgeneriertwurde.
                DerNamemussmitderZeichenfolgecustom-"odereinemalternativenPrfixbeginnen,dasSieinADAMkonfigurierthaben.
                nDasKennwortdesClients,wenndiesesnichtautomatischbeimEinrich-tendesClientkontosgeneriertwurde.
                berdieOption-unattendedwerdenimplizitdieOptionen-nonInteractive,-connectUSBOnStartup,-connectUSBOnInsertund-desktopLayoutmultimonitorfestgelegt.
                -userNameBenutzernameGibtdenKontonamenan,denderEndbenutzerzurAnmeldunganHorizonViewClientverwendet.
                DieseOptionmussfürClientsimKiosk-Mo-dusnichtangegebenwerden,wennderKontonameüberdieMAC-AdressedesClientgertsgeneriertwird.
                berdieBefehlszeileoderinderKonfigurationsdateiangegebeneOptionenhabenVorrangvorglobalenSystemrichtlinien,diewiederumBenutzerrichtlinienauerKraftsetzen.
                MitAusnahmevon-file,-languageId,-printEnvironmentInfo,-smartCardPINund-unattendedknnenalleOptionenüberActiveDirectory-Gruppenrichtlinienangegebenwerden.
                ViewClient-KonfigurationsdateiSieknnenBefehlszeileninformationenfürViewClientauseinerKonfigurationsdateiauslesen.
                SieknnendenPfadderKonfigurationsdateialsArgumentderOption-fileDateipfaddesBefehlsvmware-viewangeben.
                BeiderDateimussessichumeineUnicode-(UTF-16)oderumeineASCII-Textdateihandeln.
                Beispiel:BeispieleinerKonfigurationsdateifüreinenichtinteraktiveAnwendungDasfolgendeBeispielzeigtdieInhalteeinerKonfigurationsdateifüreinenichtinteraktiveAnwendung.
                -serverURLhttps://view.
                yourcompany.
                com-userNameautouser-passwordauto123-domainNamecompanydomain-desktopNameautodesktop-nonInteractiveKapitel3KonfigurierenvonHorizonViewClientfürEndbenutzerVMware,Inc.
                51Beispiel:BeispieleinerKonfigurationsdateifüreinenClientimKioskmodusDasfolgendeBeispielzeigteinenClientimKioskmodus,dessenKontonameaufseinerMAC-Adresseba-siert.
                DerClientverwendeteinautomatischgeneriertesKennwort.
                -serverURL145.
                124.
                24.
                100-unattendedKonfigurierendesHorizonViewClientmithilfederWindows-RegistrierungSieknnenStandardeinstellungenfürdenHorizonViewClientinderWindows-Registrierungdefinieren,anstattdieseEinstellungenüberdieBefehlszeileanzugeben.
                RichtlinieneintrgehabenPriorittvordenWindows-Registrierungseinstellungen,undBefehlszeileneinstellungenhabenPriorittvorRichtlinieneintr-gen.
                Tabelle3-11zeigtdieRegistrierungseinstellungenfürdieAnmeldungbeiHorizonViewClient.
                DieseEin-stellungenbefindensichinderRegistrierungunterHKEY_CURRENT_USER\Software\VMware,Inc.
                \VMwareVDM\Client\".
                DieserSpeicherortistspezifischfüreinenbestimmtenBenutzer,wohingegendieEinstellun-genHKEY_LOCAL_MACHINE",dieindernchstenTabellebeschriebenwerden,computerweiteEinstellungensind,diefürallelokalenBenutzerundalleDomnenbenutzerineinerWindows-Domnenumgebunggel-ten,dieüberdieBerechtigungverfügen,sichamComputeranzumelden.
                Tabelle311.
                HorizonViewClientRegistrierungseinstellungenfürAnmeldeinformationenRegistrierungs-einstellungBeschreibungKennwortBestimmtdasStandardkennwort.
                UserNameBestimmtdenstandardmigenBenutzernamen.
                Tabelle3-12zeigtdieRegistrierungseinstellungenfürHorizonViewClient,dienichtdieAnmeldeinformati-onenbeinhalten.
                DerSpeicherortdieserEinstellungenhngtvomSystemtypab:n32-Bit-Windows:HKEY_LOCAL_MACHINE\Software\VMware,Inc.
                \VMwareVDM\Client\n64-Bit-Windows:HKLM\SOFTWARE\Wow6432Node\VMware,Inc.
                \VMwareVDM\Client\Tabelle312.
                HorizonViewClient-RegistrierungseinstellungenRegistrierungs-einstellungBeschreibungDomainNameBestimmtdenstandardmigenDomnennamen.
                EnableShadeBestimmt,obdieMenüleiste(Shade)amoberenRanddesHorizonViewClient-Fenstersaktiviertist.
                DieMenüleisteiststandardmigaktiviert,mitAusnahmebeiClientsimKioskmodus.
                MitdemWertfalse"wirddieMenüleistedeaktiviert.
                ServerURLBestimmtdiestandardmigeView-VerbindungsserverinstanzanhandderURL,IP-AdresseoderdesFQDN.
                InderfolgendenTabellewerdenSicherheitseinstellungenbeschrieben,dieSiehinzufügenknnen.
                DerSpei-cherortdieserEinstellungenhngtvomSystemtypab:n32-Bit-Windows:HKEY_LOCAL_MACHINE\Software\VMware,Inc.
                \VMwareVDM\Client\Securityn64-Bit-Windows:HKLM\SOFTWARE\Wow6432Node\VMware,Inc.
                \VMwareVDM\Client\SecurityVerwendungvonVMwareViewHorizonClientfürWindows52VMware,Inc.
                Tabelle313.
                SicherheitseinstellungenRegistrierungseinstel-lungBeschreibungundgültigeWerteCertCheckModeLegtdenZertifikatsprüfungsmodusfest.
                n0implementiertServer-Identittszertifikatenichtüberprüfen.
                n1implementiertWarnungvorVerbindungmitnichtvertrauenswürdigenSer-vernausgeben.
                n2implementiertNiemitnichtvertrauenswürdigenServernverbinden.
                SSLCipherListKonfiguriertdieVerschlüsselungsliste,umdieVerwendungbestimmterkryptografischerAl-gorithmenundProtokollezubeschrnken,bevorSieeineverschlüsselteSSL-Verbindungherstellen.
                DieVerschlüsselungslistebestehtauseinerodermehrerenVerschlüsselungszei-chenfolgen,diedurchDoppelpunktevoneinandergetrenntwerden.
                HINWEISFüralleVerschlüsselungszeichenfolgenwirddieGro-/Kleinschreibungberück-sichtigt.
                WenndieseFunktionaktiviertist,lautetderStandardwertSSLv3:TLSv1:TLSv1.
                1:AES:!
                aNULL:@STRENGTH.
                Diesbedeutet,dassSSLv3.
                0,TLSv1.
                0undTLSv1.
                1aktiviertsind.
                (SSLv2.
                0undTLSv1.
                2sinddeaktiviert.
                )Verschlüsselungssammlungenverwenden128-oder256-Bit-AES,entfernenanonymeDH-AlgorithmenundsortierenanschlieenddieaktuelleVerschlüsselungslistenachderSchlüs-sellngedesVerschlüsselungsalgorithmus.
                Referenz-LinkfürdieKonfiguration:http://www.
                openssl.
                org/docs/apps/ciphers.
                htmlKapitel3KonfigurierenvonHorizonViewClientfürEndbenutzerVMware,Inc.
                53VerwendungvonVMwareViewHorizonClientfürWindows54VMware,Inc.
                VerwaltungderSerververbindungenundDesktops4MitHorizonViewClientknnenSieeineVerbindungzueinemView-VerbindungsserveroderSicherheits-serverherstellenundsichbeieinemRemote-Desktopan-oderabmelden.
                ZurFehlersucheknnenSieaucheinenIhnenzugewiesenRemote-Desktopzurücksetzen.
                Jenachdem,wiederAdministratordieRichtlinienfürRemote-Desktopsfestlegt,knnendieEndbenutzervieleverschiedeneVorgngeaufihrenDesktopsdurchführen.
                DiesesKapitelbehandeltdiefolgendenThemen:nAnmeldunganeinemView-Desktop",aufSeite55nWechselnzwischenDesktops",aufSeite58nAbmeldenoderTrennenvonDesktops",aufSeite58AnmeldunganeinemView-DesktopBevorSiedenEndbenutzernZugriffaufihrevirtuellenDesktopsgewhren,solltenSiesicherstellen,dassSiesichvoneinemClientgertausaneinemvirtuellenDesktopanmeldenknnen.
                SieknnenViewClientüberdasMenüStartodereineDesktop-VerknüpfungaufdemClientsystemstarten.
                InUmgebungen,indeneneineNetzwerkverbindungverfügbarist,wirddieBenutzersitzungvonView-Ver-bindungsserverauthentifiziert.
                VoraussetzungennBesorgenSiesichdiezurAnmeldungbentigtenInformationen,soetwadenBenutzernamenunddasKennwort,denRSASecurID-BenutzernamenunddasKennwort,denRADIUS-Authentifizierungsbe-nutzernamenoder-PasscodeoderdieSmartcard-PIN.
                nBesorgenSiesichdenDomnennamenfürdieAnmeldung.
                nFührenSiedieunterVorbereitendesView-VerbindungsserversfürHorizonViewClient",aufSeite15beschriebenenadministrativenAufgabenaus.
                nWennSiesichauerhalbdesFirmennetzwerksbefindenundfürdenZugriffaufdenRemote-DesktopkeinenSicherheitsserververwenden,stellenSiesicher,dassIhrClientgertfürdieVerwendungeinerVPN-Verbindungkonfiguriertist,undaktivierenSiedieseVerbindung.
                WICHTIGVMwareempfiehltdieVerwendungeinesSicherheitsserversanstelleeinesVPNs.
                nStellenSiesicher,dassSieüberdenvollqualifiziertenDomnennamen(FQDN)desServersverfügen,derZugriffaufdiesenRemote-Desktopgewhrt.
                SiebentigenzudemauchdiePortnummer,wennessichbeimPortnichtum443handelt.
                VMware,Inc.
                55nWennSiebeabsichtigen,dasRDP-AnzeigeprotokollzurVerbindungsherstellungmiteinemRemote-Desktopzuverwenden,müssenSiesicherstellen,dassdieViewAgent-GruppenrichtlinieneinstellungAllowDirectRDPaktiviertist.
                nWennIhrAdministratordieszulsst,knnenSiedenZertifikatsprüfungsmodusfürdasvonView-Ver-bindungsservervorgelegteSSL-Zertifikatkonfigurieren.
                InformationenzurBestimmungdeszuverwendendenModusfindenSieunterZertifikatsprüfungsmo-difürHorizonViewClient",aufSeite35.
                Vorgehensweise1DoppelklickenSieaufdieDesktop-VerknüpfungVMwareHorizonViewClientoderklickenSieaufStart>Programme>VMware>VMwareHorizonViewClient.
                2(Optional)ZurFestlegungdesZertifikatsprüfungsmodusklickenSieaufdieSchaltflcheOptioneninderoberenlinkenEckedesFenstersundwhlenSieSSLkonfigurieren.
                WieindenVoraussetzungenfürdiesesVerfahrenbeschrieben,knnenSiedieseOptionnurdannkon-figurieren,wennIhrAdministratordiesgestattet.
                3(Optional)UmsichalsderzeitangemeldeterWindows-Domnenbenutzeranzumelden,klickenSieinderoberenlinkenEckedesFenstersaufdieSchaltflcheOptionenundwhlenSieAnmeldenalsaktu-ellerBenutzer.
                DieseOptionstehtzurVerfügung,wenndasModulAnmeldenalsaktuellerBenutzeraufIhremClientsysteminstalliertistundwennderAdministratordieglobaleEinstellungfürdieseFunktionakti-vierthat.
                EinigeUnternehmenentschlieensich,dieFunktionnichtzuaktivieren.
                4KlickenSieaufdieSchaltflche+Serverhinzufügen,gebenSiedenNamendesView-Verbindungsser-versodereinesSicherheitsserversein,undklickenSieaufVerbinden.
                VerbindungenzwischenHorizonViewClientundView-VerbindungsserververwendenimmerSSL.
                DerStandardportfürSSL-Verbindungenist443.
                WennderView-VerbindungsservernichtzurVerwen-dungdesStandardportskonfiguriertist,mussdasinfolgendemBeispielgezeigteFormatverwendetwerden:view.
                company.
                com:1443.
                EswirdeventuelleineMeldungeingeblendet,dieSiebesttigenmüssen,bevordasAnmeldedialog-fenstererscheint.
                5WennSiezurEingabevonRSASecurID-oderRADIUS-Authentifizierungs-Anmeldeinformationenauf-gefordertwerden,gebenSiedenBenutzernamenunddenPasscodeeinundklickenSieaufWeiter.
                6GebenSiedieAnmeldeinformationeneinesBenutzersein,derfürdieVerwendungvonmindestensei-nemDesktop-Poolberechtigtist,whlenSiedieDomneausundklickenSieaufAnmelden.
                WennSiedenBenutzernamenmitdemFormatBenutzer@Domaeneeingeben,wirderaufgrunddesAt-Zeichens(@)alsBenutzerprinzipalname(UserPrincipalName,UPN)behandelt,unddasDropdown-MenüfürdieDomnewirdabgeblendetdargestellt.
                InformationenzurErstellungvonDesktop-PoolsundzumZuweisenvonBenutzerberechtigungenfürPoolsfindenSieimDokumentVerwaltungvonVMwareHorizonView‐.
                VerwendungvonVMwareViewHorizonClientfürWindows56VMware,Inc.
                7(Optional)ZumKonfigurierenvonAnzeigeeinstellungenklickenSieentwedermitderrechtenMaus-tasteaufeinDesktop-SymboloderSiewhleneinDesktop-SymbolausundklickenaufdieSchaltflcheEinstellungeninderoberenrechtenBildschirmecke.
                OptionBeschreibungAnzeigeprotokollWennIhrAdministratordiesgestattet,knnenSieanhandderListeVer-bindenüberzwischendenAnzeigeprotokollenPCoIPundMicrosoftRDPauswhlen.
                PCoIPbieteteinoptimiertesPC-BenutzererlebnisbeiderBe-reitstellungvonBildernsowieAudio-undVideoinhaltenimLANoderWAN.
                AnzeigelayoutVerwendenSiedieListeAnzeige,umeineFenstergreauszuwhlenodermehrereMonitorezuverwenden.
                8DoppelklickenSieaufeinRemote-Desktop-Symbol,umdieVerbindungherzustellen.
                NachdemdieVerbindunghergestelltwurde,wirddasView-Desktopfensterangezeigt.
                WennSieausmeh-rerenDesktop-Symbolenauswhlenkonnten,bleibtdasFensterzurDesktop-Auswahlgeffnet,sodassSiesichmitmehrerenDesktopsgleichzeitigverbindenknnen.
                WennkeineAuthentifizierunggegenüberView-VerbindungsservermglichistoderViewClientkeineVer-bindungmiteinemDesktopherstellenkann,führenSiediefolgendenAufgabenaus:nLegenSiefest,obderView-Verbindungsserverdahingehendkonfiguriertwerdensoll,SSLnichtzuver-wenden.
                ViewClienterfordertSSL-Verbindungen.
                PrüfenSie,obdieglobaleEinstellunginViewAd-ministratorfürdasKontrollkstchenSSLfürClient-Verbindungenverwendendeaktiviertist.
                IstdiesderFall,müssenSieentwederdasKontrollkstchenmarkieren,sodassSSLverwendetwird,oderIhreUmgebungsoeinrichten,dassdieClientseineVerbindungzueinemHTTPS-fhigenLastenausgleichodereinemanderenZwischengertherstellenknnen,daszurHerstellungeinerHTTP-VerbindungzumView-Verbindungsserverkonfiguriertist.
                nStellenSieeineordnungsgemeFunktionsweisedesSicherheitszertifikatsfürdenView-Verbindungs-serversicher.
                Wenndiesnichtzutrifft,wirdinViewAdministratormglicherweiseangezeigt,dassViewAgentinDesktopsnichterreichbarist,undüberdenbertragungsserver-Statuswirdangezeigt,dassdieKomponentenichtbereitist.
                DiessindHinweiseaufzustzlicheVerbindungsprobleme,diedurchZertifikatproblemeverursachtwerden.
                nStellenSiesicher,dassdiefürdieView-Verbindungsserver-InstanzfestgelegtenKennzeichenVerbin-dungenvondiesemBenutzererlauben.
                WeitereInformationenfindenSieimDokumentVerwaltungvonVMwareHorizonView‐.
                nStellenSiesicher,dassderBenutzerzumZugriffaufdiesenDesktopberechtigtist.
                WeitereInformatio-nenfindenSieimDokumentVerwaltungvonVMwareHorizonView‐.
                nWennSiedasRDP-AnzeigeprotokollzurVerbindungsherstellungmiteinemView-Desktopverwen-den,müssenSiebesttigen,dassderClientcomputerRemote-Desktop-Verbindungenzulsst.
                WeiterKonfigurierenSieStartoptionen.
                WennSienichtmchten,dassEndbenutzerdenHostnamenvonView-Ver-bindungsservereingebenmüssen,oderwennSieandereStartoptionenkonfigurierenmchten,verwendenSiedieViewClient-Befehlszeilenoptionen,umeineDesktop-Verknüpfungzuerstellen.
                SieheAusführenvonViewClientausderBefehlszeile",aufSeite49.
                Kapitel4VerwaltungderSerververbindungenundDesktopsVMware,Inc.
                57WechselnzwischenDesktopsWennSiemiteinemDesktopverbundensind,knnenSiezueinemanderenDesktopwechseln.
                VorgehensweiseuWhlenSieeinenRemote-DesktopaufdemselbenodereinemanderenServeraus.
                OptionAktionEinenRemote-Desktopaufdemsel-benServerauswhlenFührenSieeinenderfolgendenSchritteaus:nWhlenSieinderHorizonViewClient-MenüleisteOptionen>Zuei-nemanderenDesktopwechselnundwhlenSiedenDesktopaus,derangezeigtwerdensoll.
                nDoppelklickenSieimFensterfürdieDesktop-AuswahlaufdasSym-bolfüreinenanderenDesktop-Pool.
                DerDesktopwirdineinemneuenFenstergeffnet,sodassmehrereDesktopsgeffnetsindundSiezwi-schendiesenwechselnknnen.
                EinenRemote-DesktopaufeinemanderenServerauswhlenWennSiezurVerwendungmehrererDesktopsberechtigtsindunddes-halbdasFensterzurDesktop-Auswahlgeffnetist,wechselnSiezumFensterfürdieDesktop-Auswahl,klickenSieaufOptioneninderoberenlinkenEckedesFenstersundwhlenSieVerbindungtrennen.
                SiewerdenvomaktuellenServerundallenoffenenDesktop-Sitzungenabgemeldet.
                SieknnenanschlieendeineVerbindungmiteinemanderenServerher-stellen.
                WennSienurzurVerwendungeinesDesktopsberechtigtsind,wirddasFensterzurDesktop-Auswahlnichtgeffnet.
                SiemüssenHorizonViewClientbeendenundneustarten,umeineVerbindungmitei-nemanderenServerherzustellen.
                AbmeldenoderTrennenvonDesktopsWennSiedieVerbindungzueinemRemote-Desktoptrennen,ohnesichabzumelden,bleibendieAnwen-dungengeffnet.
                SelbstwennSiekeinenRemote-Desktopgeffnethaben,knnenSiesichvomRemote-Desktop-Betriebssys-temabmelden.
                DieVerwendungdieserOptionhatdieselbeFunktion,wiewennSiedieTastenkombinationStrg+Alt+DeletedrückenundanschlieendaufAbmeldenklicken.
                HINWEISDieEingabederWindows-TastenkombinationStrg+Alt+EntfwirdfürRemote-Desktopsnichtun-terstützt.
                WhlenSie,umdieselbenResultatewiebeieinerBettigungvonStrg+Alt+Entfzuerzielen,dieOptionenDesktop>Strg+Alt+EntfsendenausderMenüleiste.
                AlternativknnenSieindenmeistenFllenauchdieTastenkombinationStrg+Alt+Einfgbettigen.
                WennSieaufWindows8.
                1-DesktopsdasMicrosoftRDP-Anzeigeprotokollverwenden,kanndieseTastenkombi-nationnichtverwendetwerden.
                VerwendungvonVMwareViewHorizonClientfürWindows58VMware,Inc.
                VorgehensweisenTrennenSiedieVerbindung,ohnesichabzumelden.
                OptionAktionVomRemote-Desktop-FensterausFührenSieeinenderfolgendenSchritteaus:nKlickenSieaufdieSchaltflcheSchlieeninderEckedesDesktop-Fensters.
                nWhlenSieinderMenüleistedesDesktop-FenstersOptionen>Ver-bindungtrennenaus.
                ImFensterzurDesktop-AuswahlDasFensterzurDesktop-Auswahlistgeffnet,wennSieüberBerechtigun-genfürmehrereDesktopsaufdemSerververfügen.
                FührenSieeinenderfolgendenSchritteaus:nKlickenSieaufdieSchaltflcheSchlieeninderEckedesFensterszurDesktop-Auswahl,undklickenSieimWarnungsfensteraufJa.
                nKlickenSieaufdasOptionssymbolinderoberenlinkenEckedesFens-terszurDesktop-Auswahl,whlenSieVerbindungtrennenundkli-ckenSieimWarnungsfensteraufJa.
                HINWEISDerView-AdministratorkannIhrenDesktopsokonfigurieren,dassSiebeimTrennenderVerbindungautomatischabgemeldetwerden.
                IndiesemFallwerdenallegeffnetenProgrammeaufIh-remDesktopangehalten.
                nMeldenSiesichabundtrennenSiedieVerbindungzueinemDesktop.
                OptionAktionAusdemDesktop-BetriebssystemherausMeldenSiesichüberdasWindows-Start-Menüab.
                berdieMenüleisteWhlenSieOptionen>TrennenundAbmelden.
                BeiVerwendungdieserOptionwerdenalleDateien,dieaufdemRemote-Desktopgeffnetsind,ohnevorherigesSpeicherngeschlossen.
                nMeldenSiesichab,wennkeinRemote-Desktopgeffnetist.
                BeiVerwendungdieserOptionwerdenalleDateien,dieaufdemRemote-Desktopgeffnetsind,ohnevorherigesSpeicherngeschlossen.
                aStartenSieHorizonViewClient,stellenSieeineVerbindungmitderView-Verbindungsserver-In-stanzher,dieZugriffaufdenRemote-Desktopbietet,undgebenSieIhreAnmeldeinformationenfürdieAuthentifizierungan.
                bKlickenSiemitderrechtenMaustasteaufdasDesktop-SymbolundwhlenSieAbmelden.
                Kapitel4VerwaltungderSerververbindungenundDesktopsVMware,Inc.
                59VerwendungvonVMwareViewHorizonClientfürWindows60VMware,Inc.
                ArbeitenaufeinemView-Desktop5HorizonViewbietetdievertraute,individuellangepassteDesktop-Umgebung,dieBenutzererwarten.
                Be-nutzerknnenaufanihrenlokalenComputerangeschlosseneUSB-undandereGertezugreifen,Doku-menteanbeliebigeDruckersenden,dievonihremlokalenComputererkanntwerden,eineAuthentifizie-rungmithilfevonSmartcardsdurchführenundmehrereAnzeigemonitoreverwenden.
                DiesesKapitelbehandeltdiefolgendenThemen:nFunktionsunterstützungs-Matrix",aufSeite61nInternationalisierung",aufSeite62nVerwendungmehrererMonitore",aufSeite62nVerbindenvonUSB-Gerten",aufSeite63nVerwendenderEchtzeit-Audio/Video-FunktionfürWebcamsundMikrofone",aufSeite66nKopierenundEinfügenvonTextundBildern",aufSeite69nDruckenvoneinemRemote-Desktopaus",aufSeite70nSteuernderAnzeigevonAdobeFlash",aufSeite71nVerwendenderFunktionderrelativenMausbewegungfürCAD-und3D-Anwendungen",aufSei-te72Funktionsunterstützungs-MatrixVieleFunktionen,sozumBeispieldieRSASecurID-Authentifizierung,dasstandortbasierteDruckenunddasPCoIP-Protokoll,werdenaufdenmeistenClientbetriebssystemenunterstützt.
                Dabeimussjedochauchberücksichtigtwerden,obdieFunktionaufdemBetriebssystemdesView-Desktopsunterstütztwird.
                VerwendenSiebeiderPlanungundBereitstellungdesAnzeigeprotokollsundderFunktionen,diefürIhreEndbenutzerverfügbarseinsollen,diefolgendenInformationen,umzuermitteln,welcheClientbetriebssys-temeundAgent-Betriebssysteme(View-Desktop)dieFunktionunterstützen.
                Tabelle51.
                AufWindows-basiertenViewClientsunterstützteFunktionenFunktionWindowsXP-DesktopWindowsVista-DesktopWindows7-DesktopWindows8-DesktopWindowsServer2008R2-DesktopUSB-ZugriffXXXXXEchtzeit-Au-dio/Video(RTAV)XXXXXRDP-Anzeige-protokollXXXXXVMware,Inc.
                61Tabelle51.
                AufWindows-basiertenViewClientsunterstützteFunktionen(Fortsetzung)FunktionWindowsXP-DesktopWindowsVista-DesktopWindows7-DesktopWindows8-DesktopWindowsServer2008R2-DesktopPCoIP-Anzeige-protokollXXXXXPersona-Verwal-tungXXXXWyseMMRXXWindows7MMRXStandortbasier-tesDruckenXXXXVirtuellesDru-ckenXXXXSmartcardsXXXXXRSASecurIDoderRADIUSXXXXXEinmaligesAn-meldenXXXXXMehrereMonito-reXXXXXInformationendarüber,welcheEditionenbzw.
                ServicePacksdereinzelnenClientbetriebssystemeunter-stütztwerden,findenSieimAbschnittSystemanforderungen".
                FürFunktionen,dieaufWindows-DesktopsfürWindowsViewClientunterstütztwerden,geltendiefol-gendenEinschrnkungen.
                nWindows8-Desktopswerdennurunterstützt,wennSieüberServerundDesktopsmitHorizonView5.
                2oderspterverfügen.
                nDieEchtzeit-Audio/Video-Funktionwirdnurunterstützt,wennSieüberHorizonView5.
                2mitFeaturePack2oderspterverfügen.
                nWindows2008R2-Desktopswerdennurunterstützt,wennSieüberServerundDesktopsmitHorizonView5.
                3oderspterverfügen.
                WeitereErluterungenzudiesenFunktionenundderenEinschrnkungenfindenSieimDokumentPlanungderVMwareHorizonView‐‐Architektur.
                InternationalisierungDieBenutzeroberflcheunddieDokumentationsindindenSprachenEnglisch,Japanisch,Franzsisch,Deutsch,vereinfachtesChinesisch,traditionellesChinesischundKoreanischverfügbar.
                VerwendungmehrererMonitoreUnabhngigvomAnzeigeprotokollknnenSiemiteinemView-DesktopmehrereMonitoreverwenden.
                WennSiePCoIPverwenden,dasAnzeigeprotokollvonVMware,knnenSiedieAnzeigeauflsungunddieDrehungfürjedenMonitorseparatanpassen.
                PCoIPermglichteineechteSitzungmitmehrerenMonitoren,anstellevoneinerErweiterungsmodussitzung.
                VerwendungvonVMwareViewHorizonClientfürWindows62VMware,Inc.
                EineErweiterungsmodus-Remote-SitzungistimGrundeeineSitzungmiteinemMonitor.
                DieMonitoremüssendiegleicheGreundAuflsunghabenunddasMonitorlayoutmussineinenBegrenzungsrahmenpassen.
                WennSieeinAnwendungsfenstermaximieren,fülltdasFensteralleMonitoreaus.
                MicrosoftRDP6verwendetdenErweiterungsmodus.
                IneinerechtenSitzungmitmehrerenMonitoren,knnendieMonitoreunterschiedlicheAuflsungenundGrenhaben,undeinMonitorkanngeschwenktsein.
                WennSieeinAnwendungsfenstermaximieren,wirddasFensteraufdasVollbilddesMonitorserweitert,indemesangezeigtwird.
                FürdieseFunktiongeltendiefolgendenEinschrnkungen:nWennSiePCoIPverwenden,knnenSiemaximal4Monitoreverwenden,umeinenView-Desktopan-zuzeigen,undzwarmiteinerAuflsungvon2560x1600.
                DiemaximaleAnzahlMonitore,dieüberei-nandergestapeltwerdenknnen,betrgt2.
                Wenndie3D-Funktionaktiviertist,werdenbiszu2Moni-toremiteinerAuflsungvon1920x1200unterstützt.
                nWennSieMicrosoftRDP7verwenden,betrgtdiemaximaleAnzahlMonitore,dieSiezurAnzeigeei-nesView-Desktopsverwendenknnen,16.
                nWennSiedasMicrosoftRDP-Anzeigeprotokollverwenden,mussMicrosoftRemoteDesktopConnecti-on(RDC)6.
                0oderspteraufdemView-Desktopinstalliertsein.
                VerbindenvonUSB-GertenSieknnenlokalangeschlosseneUSB-Gerte,zumBeispielThumb-Flashlaufwerke,KamerasoderDrucker,voneinemRemote-Desktopausverwenden.
                DieseFunktionwirdalsUSB-Umleitungbezeichnet.
                BeiAktivierungdieserFunktionstehendiemeistenUSB-Gerte,dieandaslokaleClientsystemangeschlos-sensind,ineinemMenüinHorizonViewClientzurVerfügung.
                berdasMenüknnenSiedieGertever-bindenoderderenVerbindungtrennen.
                BeiderVerwendungvonUSB-GertenmitRemote-DesktopsgeltenfolgendeEinschrnkungen:nBeimZugriffaufeinUSB-GertvoneinemMenüinHorizonViewClientundVerwendungdesGertsineinemRemote-DesktopknnenSienichtaufdemlokalenComputeraufdasGertzugreifen.
                nZudenUSB-Gerten,dienichtimMenüangezeigtwerden,aberaufdemRemote-Desktopverfügbarsind,zhlenEingabegerte(HumanInterfaceDevices)wiezumBeispielTastaturenundZeigegerte.
                DerRemote-DesktopundderlokaleComputerverwendendieseGertegleichzeitig.
                DieInteraktionmitdiesenGertenkannaufgrundderNetzwerklatenzmanchmalrechtlangsamsein.
                nGroeUSB-FestplattenlaufwerkeknnenerstnachmehrerenMinutenaufdemDesktopangezeigtwer-den.
                nMancheUSB-GerteerfordernbestimmteTreiber.
                WenndererforderlicheTreibernichtbereitsaufdemRemote-Desktopinstalliertist,werdenSiemglicherweisebeiVerbindungdesUSB-GertsmitdemRe-mote-DesktopzuInstallationdiesesTreibersaufgefordert.
                nWennSieUSB-Gerteverbindenmchten,dieMTP-Treiberverwenden,sozumBeispielAndroid-ba-sierteSamsung-Smartphonesund-Tablets,müssenSieHorizonViewClientsoeinstellen,dassdieUSB-GerteautomatischmitIhremRemote-Desktopverbundenwerden.
                AnderenfallswirddasUSB-GertbeimVersuchdermanuellenUmleitungübereinMenüelementnurumgeleitet,wennSiedasGerttrennenundesanschlieendwiederverbinden.
                nWebcamswerdenfürdieUSB-UmleitungüberdasMenüUSB-Gertverbindennichtunterstützt.
                ZurVerwendungeinerWebcamodereinesAudioeingabegertsmüssenSiedieEchtzeit-Audio/Video-Funktionverwenden.
                DieseFunktionstehtbeiVerwendungvonVMwareHorizonView-5.
                2FeaturePack2oderspterzurVerfügung.
                SieheVerwendenderEchtzeit-Audio/Video-FunktionfürWebcamsundMikrofone",aufSeite66.
                Kapitel5ArbeitenaufeinemView-DesktopVMware,Inc.
                63nDieUmleitungvonUSB-AudiogertenistvomNetzwerkstatusabhngigunddahernichtzuverlssig.
                MancheGerteerfordernauchimRuhezustandeinenhohenDatendurchsatz.
                WennSiedieinVMwareHorizonView-5.
                2FeaturePack2oderhherenthalteneEchtzeit-Audio/Video-Funktionver-wenden,arbeitenAudioeingabe-undAudioausgabegerteordnungsgem,unddieVerwendungderUSB-UmleitungistfürdieseGertenichterforderlich.
                SieknnenUSB-GertesowohlmanuellalsauchautomatischmiteinemRemote-Desktopverbinden.
                HINWEISLeitenSiekeineUSB-GertewieUSB-Ethernet-GerteundTouchscreen-GerteandenRemote-Desktopum.
                WennSieeinUSB-Ethernet-Gertumleiten,verliertIhrlokalesClientsystemdieVerbindungzumNetzwerk.
                WennSieeinTouchscreen-Gertumleiten,empfngtderRemote-DesktopEingabenvomTouchscreenundnichtvonderTastatur.
                WennSieIhrenvirtuellenDesktopzurautomatischenVerbindungvonUSB-Gertenkonfigurierthaben,knnenSieRichtlinienkonfigurieren,umbestimmteGerteauszu-schlieen.
                SieheThemaKonfigurationderFilterrichtlinieneinstellungenfürUSB-Gerte"imDokumentVerwaltungvonVMwareHorizonView‐.
                WICHTIGIndiesemVerfahrenwirddieVerwendungdesVMwareHorizonViewClient-MenüelementszurKonfigurationderautomatischenVerbindungvonUSB-GertenmitdemRemote-Desktoperlutert.
                SieknnendieautomatischeVerbindungauchkonfigurieren,indemSiedieHorizonViewClient-Befehlszeilen-schnittstelleverwendenodereineGruppenrichtlinieerstellen.
                WeitereInformationenüberdieBefehlszeilenschnittstellefindenSieunterAusführenvonViewClientausderBefehlszeile",aufSeite49.
                WeitereInformationenzurErstellungvonGruppenrichtlinienfindenSieimDokumentVerwaltungvonVMwareHorizonView‐.
                VoraussetzungennUmUSB-GertemiteinemRemote-Desktopverwendenzuknnen,mussderView-AdministratordieUSB-FunktionfürdenRemote-Desktopaktivierthaben.
                DieseAufgabeumfasstdieInstallationderKomponenteUSB-UmleitunginViewAgent.
                WeitereInfor-mationenundAnweisungenfindenSieimKapitelüberdieErstellungundVorbereitungdervirtuellenMaschinenimDokumentVerwaltungvonVMwareHorizonView‐.
                DieAufgabekannzudemauchdasFestlegenvonGruppenrichtlinienzurZulassungderUSB-Umlei-tungumfassen.
                WeitereInformationenfindenSieindenAbschnittenUSB-EinstellungenfürViewAgent",USB-EinstellungenfürViewClient",KonfigurationderGerteaufschlüsselungs-Richtlinien-einstellungenfürUSB-Verbundgerte"undKonfigurationderFilterrichtlinieneinstellungenfürUSB-Gerte"imDokumentVerwaltungvonVMwareHorizonView‐.
                nBeiderInstallationvonHorizonViewClientmussdieKomponenteUSB-Umleitungmitinstalliertwerden.
                WennSiedieseKomponentenichtindieInstallationeingeschlossenhaben,solltenSiedasIn-stallationsprogrammerneutausführen,dieKomponentenndernunddieKomponenteUSB-Umlei-tungeinschlieen.
                VorgehensweisenVerbindenSiedasUSB-GertmanuellmiteinemRemote-Desktop.
                aSchlieenSiedasUSB-GertanIhrlokalesClientsysteman.
                bKlickenSieinderVMwareHorizonViewClient-MenüleisteaufUSB-Gertverbinden.
                cWhlenSiedasUSB-Gertaus.
                DasGertwirdmanuellvomlokalenSystemandenRemote-Desktopumgeleitet.
                VerwendungvonVMwareViewHorizonClientfürWindows64VMware,Inc.
                nKonfigurierenSieHorizonViewClientdahingehend,dassUSB-GerteautomatischmitdemRemote-Desktopverbundenwerden,wennSiedieseandaslokaleSystemanschlieen.
                VerwendenSiedieseFunktionzurautomatischenVerbindungsherstellungunbedingtdann,wennSieGertemitMTP-Treibernverwendenmchten,sozumBeispielAndroid-basierteSamsung-Smartpho-nesund-Tablets.
                aBevorSiedasUSB-Gertanschlieen,startenSieHorizonViewClientundstellenSiedieVerbin-dungmiteinemRemote-Desktopher.
                bKlickenSieinderVMwareHorizonViewClient-MenüleisteaufUSB-Gertverbinden>USB-Ge-rtebeiEinführenautomatischverbinden.
                cSchlieenSiedasUSB-Gertan.
                USB-Gerte,dieSienachdemStartvonHorizonViewClientanIhrlokalesSystemanschlieen,werdenandenRemote-Desktopumgeleitet.
                nKonfigurierenSieHorizonViewClientzurautomatischenVerbindungvonUSB-GertenmitdemRe-mote-Desktop,wennHorizonViewClientgestartetwird.
                aKlickenSieinderVMwareHorizonViewClient-MenüleisteaufUSB-Gerteverbinden>USB-Ge-rtebeiStartautomatischverbinden.
                bSchlieenSiedasUSB-GertanundstartenSieHorizonViewClientneu.
                USB-Gerte,dieSiebeimStartvonHorizonViewClientanIhrlokalesSystemanschlieen,werdenandenRemote-Desktopumgeleitet.
                DasUSB-GertwirdaufdemDesktopangezeigt.
                DieserVorgangkannbiszu20Sekundendauern.
                Beierst-maligerVerbindungvonGertundDesktopwerdenSieeventuelldazuaufgefordert,bestimmteTreiberzuinstallieren.
                WirddasUSB-GertauchnachmehrerenMinutennichtaufdemDesktopangezeigt,solltenSiedieVerbin-dungtrennenunddasGertanschlieendneumitdemClientcomputerverbinden.
                WeiterBeiProblemenmitderUSB-UmleitungfindenSieweitereInformationenimKapitelüberdieBehebungvonProblemenbeiderUSB-UmleitungimDokumentVerwaltungvonVMwareHorizonView‐.
                KonfigurierenvonClientszurerneutenVerbindungbeimNeustartderUSB-GerteWennSieViewClientnichtzurautomatischenVerbindungderUSB-GertemitIhremView-Desktopkonfi-gurieren,knnenSieimmernochfestlegen,dassViewClientmitbestimmtenGerten,diegelegentlichneustarten,wiedereineVerbindungherstellt.
                WennanderenfallseinGertwhrendeinesUpgrade-Vorgangsneustartet,stellteseineVerbindungzumlokalenSystem,anstattzumView-Desktopher.
                WennSiealsUSB-GertzumBeispieleinSmartphoneodereinTabletverbindenmchten,welchesbeiBe-triebssystem-Upgradesautomatischneugestartetwird,knnenSieViewClientdazuanweisen,dasbe-stimmteGerterneutmitdemView-Desktopzuverbinden.
                ZumDurchführendieserAufgabemussdieKonfigurationsdateiaufdemClientbearbeitetwerden.
                WennSiedieOptionNachEinführungautomatischverbindeninViewClientverwenden,werdenalleGe-rte,dieSieamClientsystemanschlieen,andenView-Desktopumgeleitet.
                WennSienichtmchten,dassalleGerteverbundenwerden,solltenSiediefolgendeVorgehensweisezurKonfigurationvonViewClientanwenden,sodassnurbestimmteUSB-Gerteautomatischneuverbundenwerden.
                VoraussetzungenErmittelnSiedashexadezimaleFormatderHersteller-ID(VID)undderProdukt-ID(PID)desGerts.
                An-weisungenhierzufindenSieimVMwareKB-Artikelhttp://kb.
                vmware.
                com/kb/1011600.
                Kapitel5ArbeitenaufeinemView-DesktopVMware,Inc.
                65Vorgehensweise1ffnenSiedieDateiconfig.
                iniineinemText-EditoraufdemClient.
                BetriebssystemversionDateipfadWindows7C:\ProgramData\VMware\VMwareUSBArbitrationService\con-fig.
                iniWindowsXPC:\DokumenteundEinstellungen\AlleBenutzer\Anwendungsda-ten\VMware\VMwareUSBArbitrationService\config.
                ini2LegenSiedieEigenschaftslow-reconnectfürdasbestimmteGertoderdieGertefest.
                usb.
                quirks.
                device0="vid:pidslow-reconnect"Hierstehenvid:pidjeweilsfürdieHersteller-unddieProdukt-ID(imhexadezimalenFormat)desGe-rts.
                DiefolgendenZeilenlegendieseEigenschaftbeispielsweisefürzweiUSB-Gertefest:usb.
                quirks.
                device0="0x0529:0x0001slow-reconnect"usb.
                quirks.
                device1="0x0601:0x0009slow-reconnect"GebenSiedieGerteeigenschaftenusb.
                quirks.
                deviceNinderrichtigenReihenfolge,beginnendbei0,an.
                FolgtaufdieZeileusb.
                quirks.
                device0zumBeispielnichteineZeilemitusb.
                quirks.
                device1,son-derneineZeilemitusb.
                quirks.
                device2,wirdnurdieersteZeilegelesen.
                WennnunfürGertewieSmartphonesoderTabletseinUpgradederFirmwareoderdesBetriebssystemsdurchgeführtwird,verluftdasUpgradeerfolgreich,dadasGertneustartetunddieVerbindungzudemView-Desktopherstellt,welcherdasGertverwaltet.
                VerwendenderEchtzeit-Audio/Video-FunktionfürWebcamsundMikrofoneMitderEchtzeit-Audio/Video-FunktionknnenSiedieWebcamoderdasMikrofonIhreslokalenCompu-tersaufIhremRemote-Desktopverwenden.
                DieseFunktionstehtbeiVerwendungvonVMwareHorizonView-5.
                2FeaturePack2oderspterzurVer-fügung.
                InformationenüberdasEinrichtenderEchtzeit-Audio/Video-FunktionundüberdasKonfigurierenderFrame-RateundBildauflsungineinemRemote-DesktopfindenSieimHandbuchInstallationundVer‐waltungvonVMwareHorizonViewFeaturePack.
                InformationenzumKonfigurierendieserEinstellungenaufClientsystemenfindenSieimVMwareKB-ArtikelFestlegenvonFrame‐RatenundAuflsungfürEchtzeit‐Au‐dio/VideoaufHorizonViewClientsunterhttp://kb.
                vmware.
                com/kb/2053644.
                AufderWebsitehttp://labs.
                vmware.
                com/flings/real-time-audio-video-test-applicationknnenSieeineTes-tanwendungherunterladen,mitderüberprüftwird,obdieEchtzeit-Audio/Video-Funktionordnungsgeminstalliertistundfehlerfreiarbeitet.
                DieseTestanwendungistalsVMware-Flingverfügbar,weshalbkeintechnischerSupportbesteht.
                IndiesenFllenknnenSieIhreWebcamverwendenWennIhrHorizonView-AdministratordieEchtzeit-Audio/Video-FunktionkonfigurierthatundSiedasPCoIP-Anzeigeprotokollverwenden,kanneineintegrierteoderanIhrenlokalenComputerangeschlosseneWebcamaufIhremDesktopverwendetwerden.
                SieknnendieWebcaminKonferenzanwendungenwiez.
                B.
                Skype,WebexoderGoogleHangoutsverwenden.
                WhrendderEinrichtungvonAnwendungenwiez.
                B.
                Skype,WebexoderGoogleHangoutsaufIhremRe-mote-DesktopknnenSieVMwareVirtualMicrophoneundVMwareVirtualWebcamalsEingabegerteundVMwareVirtualAudioalsAusgabegertindenMenüsderAnwendungauswhlen.
                BeivielenAnwen-dungenkanndieseFunktionohnedieAuswahleinesEingabegertsgenutztwerden.
                VerwendungvonVMwareViewHorizonClientfürWindows66VMware,Inc.
                WenndieWebcamzurzeitvonIhremlokalenComputergenutztwird,kannsienichtgleichzeitigvomRe-mote-Desktopverwendetwerden.
                GenausokanndieWebcamnichtvomlokalenComputerverwendetwer-den,wennsiezurzeitvomRemote-Desktopgenutztwird.
                WICHTIGWennSieeineUSB-Webcamverwenden,verbindenSiediesenichtüberdasMenüUSB-GertverbindeninHorizonViewClient.
                Dieswürdedazuführen,dassdieUSB-UmleitungfürdasGertakti-viertwirdunddieLeistungfüreinenVideochatnichtausreicht.
                WennmehralseineWebcamanIhrenlokalenComputerangeschlossenist,kannIhrAdministratoreinebe-vorzugteWebcamkonfigurieren,dieaufIhremRemote-Desktopverwendetwird.
                StimmenSiesichmitIh-remHorizonView-Administratorab,wennSiesichbezüglichderWebcamauswahlnichtsichersind.
                AuswhleneinerbevorzugtenWebcamaufeinemWindows-ClientsystemWennSiedieEchtzeit-Audio/Video-FunktioneinsetzenundaufIhremClientsystemübermehrereWebcamsverfügen,wirdnureinedavonaufIhremView-Desktopverwendet.
                ZurFestlegungeinerbevorzugtenWebcamknnenSieeinenRegistrierungsschlüsselwertfestlegen.
                DiebevorzugteWebcamwirdaufdemRemote-Desktopverwendet,sofernsieverfügbarist.
                AndernfallswirdeineandereWebcamverwendet.
                VoraussetzungennStellenSiesicher,dassaufIhremClientsystemeineUSB-Webcaminstalliertundbetriebsbereitist.
                nVergewissernSiesich,dassSiedasPCoIP-AnzeigeprotokollfürIhrenRemote-Desktopverwenden.
                Vorgehensweise1SchlieenSiedieWebcaman,dieSieverwendenmchten.
                2StartenSieeinenAnruf,undstoppenSiedenAnruf.
                AufdieseWeisewirdeineProtokolldateierstellt.
                3ffnenSiedieDebug-ProtokolldateimiteinemTexteditor.
                BetriebssystemProtokolldatei,SpeicherortWindowsXPC:\DokumenteundEinstellungen\Benutzername\LokaleEinstel-lungen\Anwendungsdaten\VMware\VDM\Logs\debug-20JJ-MM-TT-XXXXXX.
                txtWindows7oderWindows8C:\Benutzer\%username%\AppData\Local\VMware\VDM\Logs\de-bug-20JJ-MM-TT-XXXXXX.
                txtDasFormatderProtokolldateilautetdebug-20JJ-MM-TT-XXXXXX.
                txt,wobei20JJfürdasJahr,MMfürdenMonat,TTfürdenTagundXXXXXXfüreineNummersteht.
                4DurchsuchenSiedieProtokolldateinach[ViewMMDevRedir]VideoInputBase::LogDevEnum,umdiePro-tokolldateieintrgezufinden,indenendieangeschlossenenWebcamsreferenziertwerden.
                NachfolgendsehenSieeinenAuszugausderProtokolldateizurIdentifikationderMicrosoftLifecamHD-5000-Webcam:[ViewMMDevRedir]VideoInputBase::LogDevEnum-2Device(s)found[ViewMMDevRedir]VideoInputBase::LogDevEnum-Index=0Name=IntegratedWebcamUse-rId=vid_1bcf&pid_2b83&mi_00#7&1b2e878b&0&0000SystemId=\\\usb#vid_1bcf&pid_2b83&mi_00#[ViewMMDevRedir]VideoInputBase::LogDevEnum-Index=1Name=MicrosoftLifeCamHD-5000Use-rId=vid_045e&pid_076d&mi_00#8&11811f49&0&0000SystemId=\\\usb#vid_045e&pid_076d&mi_00#Kapitel5ArbeitenaufeinemView-DesktopVMware,Inc.
                675KopierenSiedieBenutzer-IDderbevorzugtenWebcam.
                Beispiel:KopierenSievid_045e,umdieMicrosoftLifeCamHD-5000alsStandardwebcamfestzulegen.
                6StartenSiedenRegistrierungs-Editor(regedit.
                exe)undnavigierenSiezuHKEY_LOCAL_MACHINE\SOFT-WARE\VMware,Inc.
                \VMwareVDM\RTAV.
                7FügenSiedenID-BestandteilderZeichenfolgenindenREG_SZ-WertsrcWCamIdein.
                Beispiel:FügenSievid_045einsrcWCamIdein.
                8SpeichernSieIhrenderungenundbeendenSiedieRegistrierung.
                9StartenSieeinenneuenAnruf.
                AuswhleneinesStandardmikrofonsaufeinemWindows-ClientsystemWennSieaufIhremClientsystemübermehrereMikrofoneverfügen,wirdnureinesdavonaufIhremView-Desktopverwendet.
                ZurFestlegung,welchesMikrofonstandardmigverwendetwerdensoll,knnenSiedieOptionSound"aufIhremClientsystemverwenden.
                MitderEchtzeit-Audio/Video-FunktionarbeitenAudioeingabe-undAudioausgabegerteohneVerwen-dungderUSB-Umleitungordnungsgem,unddieerforderlicheNetzwerkbandbreitewirderheblichver-ringert.
                AnalogeAudioeingabegertewerdenebenfallsunterstützt.
                WICHTIGWennSieeinUSB-Mikrofonverwenden,verbindenSiediesesnichtüberdasMenüUSB-GertverbindeninHorizonViewClient.
                IndiesemFallwürdedasGertüberdieUSB-Umleitungumgeleitet,so-dassdieEchtzeit-Audio/Video-Funktionnichtgenutztwerdenkann.
                VoraussetzungennStellenSiesicher,dasseinUSB-MikrofonodereinandererMikrofontypaufIhremClientsysteminstal-liertundbetriebsbereitist.
                nVergewissernSiesich,dassSiedasPCoIP-AnzeigeprotokollfürIhrenRemote-Desktopverwenden.
                Vorgehensweise1WennSiegeradeeinenAnrufttigen,beendenSiedasGesprch.
                2KlickenSiemitderrechtenMaustasteaufdasLautsprechersymbolinderSystemleisteundwhlenSieAufnahmegerte.
                AlternativknnenSiedieOptionSound"inderSystemsteuerungffnenundaufdieRegisterkarteAufnahmeklicken.
                3KlickenSieimDialogfeldSoundaufderRegisterkarteAufnahmemitderrechtenMaustasteaufdasMikrofon,dasSieverwendenmchten.
                4WhlenSieAlsStandardgertauswhlenundklickenSieaufOK.
                5StartenSieüberView-DesktopeinenneuenAnruf.
                VerwendungvonVMwareViewHorizonClientfürWindows68VMware,Inc.
                KopierenundEinfügenvonTextundBildernSieknnenstandardmigTextvonIhremClientsystemaufeinenRemote-Desktopkopierenundeinfügen.
                WennIhrAdministratordieFunktionaktiviert,knnenSieauchTextzwischeneinemRemote-DesktopundIhremClientsystemoderzwischenzweiRemote-Desktopskopierenundeinfügen.
                HierfürgeltenallerdingseinigeEinschrnkungen.
                WennSiedasPCoIP-AnzeigeprotokollsowieeinenHorizonView-Remote-DesktopvomTyp5.
                xodereineneuereVersionverwenden,kannIhrView-AdministratordieseFunktionsoeinstellen,dassKopier-undEinfügevorgngenurvonIhremClientsystemaufeinenRemote-DesktopodernurvoneinemRemote-Desk-topzuIhremClientsystemoderbeideVorgngezugelassenwerdenbzw.
                keinerderbeidenVorgngezuge-lassenwird.
                DieAdministratorenkonfigurierendieMglichkeitzumKopieren/EinfügendurchdieVerwendungvonGruppenrichtlinienobjekten(GPOs),dieViewAgentaufdenRemote-Desktopszugeordnetsind.
                WeitereIn-formationenfindenSieunterdemThemaüberallgemeineSitzungsvariablenvonViewPCoIPimDokumentVerwaltungvonVMwareHorizonView‐imKapitelüberdieKonfigurationsrichtlinien.
                ZudenunterstütztenDateiformatengehrenText,BilderundRTF(RichTextFormat).
                InderZwischenabla-geknnenbiszu1MBanDatenfürKopier-undEinfügevorgngegespeichertwerden.
                WennSieformatier-tenTextkopieren,handeltessichbeidenDatenteilweiseumTextundteilweiseumFormatierungsinforma-tionen.
                EinDokumentmiteinerGrevon800KBkannbeimKopiereneineDatenmengevonmehrals1MBbesitzen,damehrals200KBanRTF-DateninderZwischenablagegespeichertwerden.
                WennSiedahereinegroeMengeanformatiertemTextoderTextundeinBildkopieren,kannesbeimEin-fügendazukommen,dassSiedenTextganzoderteilweisesehen,nichtaberdieFormatierungoderdasBild.
                Diesliegtdaran,dassdiedreiArtenvonDatenseparatgespeichertwerdenknnen.
                JenachArtdesDokuments,vondemausSiekopieren,knnenBildermglicherweisealsBilderoderalsRTF-Datengespei-chertwerden.
                BetrgtdieGesamtmengevonTextundRTFwenigerals1MB,wirdderformatierteTexteingefügt.
                EsisthufigderFall,dassdieRTF-Datennichtgekürztwerdenknnen,sodassdieRTF-DatenverworfenundnurderreineTexteingefügtwird,solltenTextundFormatierungzusammenmehrals1MBumfassen.
                SolltenSienichtinderLagesein,dengesamtenformatiertenTextunddievonIhnenausgewhltenBildereinzufügen,versuchenSiegeringereTeilmengenzuspeichernundeinzufügen.
                SieknnenkeineDateienzwischeneinemRemote-DesktopunddemDateisystemaufIhremClientcompu-terkopierenundeinfügen.
                Kapitel5ArbeitenaufeinemView-DesktopVMware,Inc.
                69DruckenvoneinemRemote-DesktopausSieknnenvoneinemRemote-DesktopausDokumenteaufeinemvirtuellenDruckerodereinemUSB-Dru-ckerausdrucken,dermitIhremClientcomputerverbundenist.
                DievirtuelleDruckfunktionunddasDru-ckenmitUSB-UmleitungknnenohneKonfliktegemeinsameingesetztwerden.
                FestlegenvonDruckeinstellungenfürdievirtuelleDruckfunktionDievirtuelleDruckfunktionermglichtEndbenutzerndasVerwendenvonlokalenoderNetzwerkdruckernaufeinemRemote-Desktop,ohnedassimRemote-DesktopzustzlicheDruckertreiberinstalliertwerdenmüssen.
                FürjedenDrucker,derüberdieseFunktionzurVerfügungsteht,knnenSieVoreinstellungenfürDatenkomprimierung,Druckqualitt,doppelseitigenDruck,Farbeusw.
                festlegen.
                NachdemdemlokalenComputereinDruckerhinzugefügtwurde,fügtHorizonViewClientdiesenDruckerderListederverfügbarenDruckeraufdemRemote-Desktophinzu.
                KeineweitereKonfigurationisterfor-derlich.
                BenutzermitAdministratorrechtenknnenweiterhinDruckertreiberaufdemRemote-Desktopin-stallieren,ohneeinenKonfliktmitdervirtuellenDruckfunktionzuverursachen.
                WICHTIGDieseFunktionstehtfürdiefolgendenDruckertypennichtzurVerfügung:nUSB-Drucker,diedieUSB-UmleitungsfunktionzurVerbindungmiteinemvirtuellenUSB-PortimRe-mote-DesktopverwendenSiemüssendenUSB-DruckerimRemote-Desktoptrennen,umdievirtuelleDruckfunktionverwendenzuknnen.
                nDieWindows-FunktionfürdieAusgabeineinerDateiDasKontrollkstchenAusgabeinDateiimDialogfeldDruckenkannnichtausgewhltwerden.
                EinDruckertreiber,überdeneineDateierstelltwird,kannverwendetwerden.
                BeispielsweiseknnenSieeinenPDF-WriterzumDruckeneinerPDF-Dateiverwenden.
                DiesesVerfahrenbeschreibtdieSchritteaufeinemRemote-DesktopmiteinemWindows7-oderWind-ows8.
                x-Betriebssystem(Desktop).
                DieVorgehensweisehneltderfürWindowsXPundWindowsVista,istabernichtvollstndiggleich.
                VoraussetzungenStellenSiesicher,dassdievirtuelleDruckfunktionvonViewAgentaufdemRemote-Desktopinstalliertist.
                DieTreiberbefindensichimRemote-Desktop-DateisystemunterC:\Programme\GemeinsameDateien\VMwa-re\Drivers\VirtualPrinter.
                DieInstallationvonViewAgentisteinederAufgaben,dieimRahmenderVorbereitungeinervirtuellenMaschineaufdieVerwendungalsRemote-Desktopdurchgeführtwerdenmuss.
                WeitereInformationenfin-denSieimDokumentVerwaltungvonVMwareHorizonView.
                Vorgehensweise1KlickenSieaufeinemRemote-DesktopmitWindows7oderWindows8.
                xaufStart>GerteundDru-cker.
                2KlickenSieimFensterGerteundDrucker"mitderrechtenMaustasteaufdenStandarddruckerundwhlenSieausdemKontextmenüDruckereigenschaftenunddanndenDruckeraus.
                AufdemRemote-DesktopwerdenvirtuelleDruckerals#:angezeigt.
                3KlickenSieimFenstermitdenDruckereigenschaftenaufdieRegisterkarteGerteeinstellungenundgebenSiediezuverwendendenEinstellungenan.
                4KlickenSieaufderRegisterkarteAllgemeinaufEinstellungenundgebenSiediezuverwendendenEinstellungenan.
                VerwendungvonVMwareViewHorizonClientfürWindows70VMware,Inc.
                5KlickenSieimDialogfeldmitdenDruckeinstellungenaufdieverschiedenenRegisterkartenundgebenSiean,welcheEinstellungenverwendetwerdensollen.
                FürdieerweiterteEinstellungSeitenanpassungempfiehltVMware,dieStandardeinstellungenbeizu-behalten.
                6KlickenSieaufOK.
                VerwendenvonUSB-DruckernIneinerHorizonView-UmgebungknnenvirtuelleDruckerundumgeleiteteUSB-DruckerohneKonfliktemiteinanderverwendetwerden.
                EinUSB-DruckeristeinDrucker,deraneinenUSB-PortaufdemlokalenClientsystemangeschlossenist.
                ZumSendenvonDruckauftrgenaneinenUSB-DruckerknnenSieentwederdieUSB-UmleitungsfunktionoderdievirtuelleDruckfunktionverwenden.
                DerUSB-DruckistgelegentlichschnelleralsdervirtuelleDruck,abhngigvondenNetzwerkbedingungen.
                nSieknnendieUSB-UmleitungsfunktionzumAnschlieeneinesUSB-DruckersaneinenvirtuellenUSB-PortaufdemRemote-Desktopverwenden,soferndieerforderlichenTreiberaufdemRemote-Desktopinstalliertsind.
                WennSiedieseUmleitungsfunktionverwenden,istderDruckernichtlngerlogischandenphysischenUSB-PortaufdemClientangeschlossen.
                AusdiesemGrundwirdderUSB-DruckernichtmehrinderListederlokalenDruckerangezeigt.
                Diesbedeutetauch,dassSieüberdenUSB-DruckeraufdemRe-mote-Desktopdruckenknnen,nichtjedochüberdielokaleClientmaschine.
                AufdemRemote-DesktopwerdenumgeleiteteUSB-Druckeralsangezeigt.
                InformationenzurVerbindungsherstellungmiteinemUSB-DruckerfindenSieunterVerbindenvonUSB-Gerten",aufSeite63.
                nAufeinigenClientsknnenSiealternativdievirtuelleDruckfunktionnutzen,umDruckauftrgeanei-nenUSB-Druckerzusenden.
                WennSiedievirtuelleDruckfunktionverwenden,knnenSiesowohlüberdenRemote-DesktopalsauchüberdenlokalenClientaufdemUSB-Druckerdrucken,undesistnichterforderlich,DruckertreiberaufdemRemote-Desktopzuinstallieren.
                SteuernderAnzeigevonAdobeFlashDerView-AdministratorkanndenAdobeFlash-Inhaltsoeinrichten,dasseraufIhremView-DesktopaufeinerStufeangezeigtwird,diemglichstwenigRechenressourceninAnspruchnimmt.
                ManchmalknnendieseEinstellungenzueinerschlechtenWiedergabequalittbeitragen.
                WennSiemitdemMauszeigeraufdenAdobeFlash-Inhaltzeigen,knnenSiedieAdobeFlash-Einstellungenüberschreiben,dieIhrView-Ad-ministratorfestgelegthat.
                DieAdobeFlash-AnzeigesteuerungstehtnurinInternetExplorer-SitzungenunterWindowszurVerfügungsowienurbeidenAdobeFlash-Versionen9und10.
                ZurSteuerungderAdobeFlash-AnzeigequalittdarfAdobeFlashnichtimVollbildmodusausgeführtwerden.
                Vorgehensweise1NavigierenSieimInternetExplorerimView-DesktopzudementsprechendenAdobeFlash-InhaltundstartenSieihn,fallserforderlich.
                JenachKonfigurationderAdobeFlash-EinstellungendurchIhrenView-AdministratorwerdenIhnenDroppedFrames",d.
                h.
                ausgelasseneVideoframes,odereinegeringereWiedergabequalittauffallen.
                2BewegenSiedenMauszeigerwhrendderWiedergabeaufdenAdobeFlash-Inhalt.
                DieAnzeigequalittverbessertsich,solangederCursoraufdemAdobeFlash-Inhaltbleibt.
                3UmdieQualittsverbesserungbeizubehalten,doppelklickenSieaufdenAdobeFlash-Inhalt.
                Kapitel5ArbeitenaufeinemView-DesktopVMware,Inc.
                71VerwendenderFunktionderrelativenMausbewegungfürCAD-und3D-AnwendungenWennSiedasPCoIP-AnzeigeprotokollbeiCAD-oder3D-AnwendungenineinemHorizonView5.
                2-Desk-topoderhherverwenden,knnenSiedieMausleistungdurchAktivierungderFunktionfürdierelativeMausbewegungverbessern.
                IndenmeistenFllen,wennSieAnwendungenverwenden,diekein3D-Renderingerfordern,übertrgtViewClientInformationenüberdieMauszeigerbewegungenmithilfevonabsolutenKoordinaten.
                BeiderVerwendungvonabsolutenKoordinatenrendertderClientdieMausbewegungenlokal,wodurchdieLeis-tunginsbesonderedannverbessertwird,wennSiesichauerhalbdesFirmennetzwerksbefinden.
                BeiderArbeitmitgrafikintensivenAnwendungenwieAutoCADoderbei3D-VideospielenknnenSiedieMausleistungverbessern,indemSiedieFunktionfürdierelativeMausbewegungaktivieren.
                DieseFunktionverwendetrelativestattabsoluterKoordinaten.
                UmdieseFunktionzuverwenden,whlenSieOptionen>RelativeMausaktiviereninderViewClient-Menüleiste.
                HINWEISWennSieViewClientimFenstermodusundnichtimVollbildmodusverwendenunddieFunkti-onderrelativenMausbewegungaktiviertist,knnenSiemglicherweisedenMauszeigernichtaufdieViewClient-MenüoptionenoderausdemViewClient-Fensterhinausbewegen.
                UmdieseSituationzubeheben,drückenSieStrg+Alt.
                WenndieFunktionderrelativenMausbewegungaktiviertist,kanndiePerformancelangsamsein,wennSiesichauerhalbdesFirmennetzwerksineinemWANbefinden.
                WICHTIGFürdieseFunktionwirdeinHorizonView5.
                2-Desktopoderhherbentigt,undSiemüssendas3D-RenderingfürdenDesktop-Pooleinschalten.
                WeitereInformationenzuPool-EinstellungenunddenOp-tionenfür3D-RenderingfindenSieimDokumentVerwaltungvonVMwareHorizonView‐.
                VerwendungvonVMwareViewHorizonClientfürWindows72VMware,Inc.
                FehlerbehebungfürHorizonViewClient6SieknnendiemeistenProblememitHorizonViewClientlsen,indemSiedenDesktopzurücksetzenoderdieVMwareHorizonViewClient-Anwendungneuinstallieren.
                DiesesKapitelbehandeltdiefolgendenThemen:nVorgehensweise,wennViewClientunerwartetbeendetwird",aufSeite73nZurücksetzeneinesDesktops",aufSeite73nDeinstallierenvonHorizonViewClient",aufSeite74Vorgehensweise,wennViewClientunerwartetbeendetwirdViewClientwirdmglicherweisebeendet,selbstwennSiedieAnwendungnichtschlieen.
                ProblemViewClientwirdmglicherweiseunerwartetbeendet.
                AbhngigvonIhrerView-Verbindungsserver-Konfi-gurationkanneineMeldungwiediefolgendeangezeigtwerden:EsbestehtkeinesichereVerbindungmitView-Verbindungsserver.
                InmanchenFllenwirdjedochkeineMeldungangezeigt.
                UrsacheDiesesProblemtrittauf,wenndieVerbindungzuView-Verbindungsservergetrenntwird.
                LsunguStartenSieViewClientneu.
                SobaldView-Verbindungsserverwiederausgeführtwird,knnenSieer-folgreicheineVerbindungherstellen.
                SolltenweiterhinProblememitderVerbindungbestehen,wen-denSiesichanIhrenView-Administrator.
                ZurücksetzeneinesDesktopsEventuellmussderDesktopzurückgesetztwerden,wenndasDesktop-Betriebssystemnichtmehrreagiert.
                BeimZurücksetzenwirdderDesktopheruntergefahrenundneugestartet.
                NichtgespeicherteDatengehenverloren.
                DasZurücksetzeneinesRemote-DesktopsentsprichtdemBettigenderReset-TasteaufeinemphysischenComputer,mitderderNeustartdesComputerserzwungenwird.
                AlleDateien,dieaufdemRemote-Desk-topgeffnetsind,werdenohnevorherigesSpeicherngeschlossen.
                SieknnendenDesktopnurzurücksetzen,wennIhrView-AdministratordieseFunktionaktivierthat.
                VMware,Inc.
                73VorgehensweiseuVerwendenSiedenDesktopzurücksetzen-Befehl.
                OptionAktionAusdemDesktop-BetriebssystemherausWhlenSieOptionen>DesktopzurücksetzenausderMenüleiste.
                InderDesktop-AuswahllisteaStartenSieHorizonViewClient,stellenSieeineVerbindungmitderView-Verbindungsserver-Instanzher,dieZugriffaufdenRemote-Desktopbietet,undgebenSieIhreAnmeldeinformationenfürdieAu-thentifizierungan.
                bWechselnSiezumFensterfürdieDesktop-Auswahl,klickenSiemitderrechtenMaustasteaufdasDesktop-SymbolundwhlenSieDesk-topzurücksetzen.
                DasBetriebssystemimRemote-Desktopwirdneugestartet.
                HorizonViewClientwirdvomDesktopge-trennt.
                WeiterWartenSieeineWeile,bisdasSystemgestartetwurde,undversuchenSieanschlieend,eineVerbindungzumRemote-Desktopherzustellen.
                DeinstallierenvonHorizonViewClientManchmalknnenSieProblememitHorizonViewClienteinfachdadurchbeheben,dassSiedieHorizonViewClient-Anwendungdeinstallierenundanschlieendneuinstallieren.
                DieVorgehensweisebeimDeinstallierenvonHorizonViewCliententsprichtderVorgehensweisebeiderDeinstallationandererAnwendungen.
                VerwendenSiebeispielsweisedasAppletSoftwareIhresWindows-Betriebssystems,umdieVMwareHorizonViewClient-Anwendungzuentfernen.
                NachdemSiedieDeinstallationdurchgeführthaben,knnenSiedieAnwendungvonneueminstallieren.
                SieheKapitel2,InstallationvonViewClientfürWindows",aufSeite19.
                VerwendungvonVMwareViewHorizonClientfürWindows74VMware,Inc.
                IndexZahlen3D-Anwendungen72AAbmeldung58ADM-Vorlagendateien,View-Komponenten37AdobeFlash-Video,Steuern71AdobeMediaServer11AnmeldunganeinemvirtuellenDesktop55AnzeigeprotokolleMicrosoftRDP61ViewPCoIP61automatischeVerbindungvonUSB-Gerten63BBetriebssystem-,UnterstützungaufViewAgent15Bilder,kopieren69Browseranforderungen14CCAD-Anwendungen72Client,Softwareanforderungen7clientseitigeGPOs37DDeinstallierenvonViewClient74DesktopAbmelden58wechseln58zurücksetzen73Desktopzurücksetzen73DruckenübereinenDesktop70Drucker,einrichten70EEchtzeit-Audio/Video,Systemanforderungen9FFirefox,unterstützteVersionen14FlashURL-Umleitung,Systemanforderungen11Funktionsunterstützungs-Matrix61GGerten,VerbindenvonUSB-63,65GPO-Einstellungen,Allgemein45Gruppenrichtlinien37HHardwareanforderungenfürWindows-Systeme8Smartcard-Authentifizierung13HorizonViewClientDownloadüberViewPortal21Fehlerbehebung73TrennenderVerbindungmiteinemDesk-top58IInternetExplorer,unterstützteVersionen14MMediendateiformate,unterstützte10mehrereMonitore62MenübefehlStrg+Alt+Entfsenden58MicrosoftLync-Unterstützung12MicrosoftRDP61,62MicrosoftWindowsInstallerBefehlszeilenoptionenfürdieunbeaufsichtigteInstallation25EigenschaftenfürViewClient24Mikrofon68Multimedia-Umleitung(MMR)10PPCoIP61ProgrammzurVerbesserungderBenutzerf-reundlichkeit,Desktop-Pool-Daten16RRDP-GPO-Einstellungen42RegistrierungBefehlszeilenbefehlenentsprechendeEinstel-lungen52EinstellungenfürViewClient52relativeMaus72SSerververbindungen55SicherheitseinstellungenfürGPOs38Sicherheitsserver15Smartcard-Authentifizierung,Anforderungen13SSL-Zertifikate,berprüfen34VMware,Inc.
                75Steuern,AdobeFlash-Videoanzeige71StreamingvonMultimedia10Strg+Alt+Entf58Systemanforderungen,fürWindows8TText,kopieren69TextundBildereinfügen69TextundBilderkopieren69ThinClient-Unterstützung61ThinPrint-Einrichtung70TrennenderVerbindungmiteinemRemote-Desktop58UberprüfungdesServerzertifikats34berprüfungsmodifürdieZertifikatsprüfung34unbeaufsichtigteInstallation,ViewClient23UnbeaufsichtigteInstallation,ViewClient23UnifiedCommunications12UPNs,ViewClient55URI-Beispiele33URI-SyntaxfürViewClients30URIs(UniformResourceIdentifier)30USB-Drucker70,71USB-Einstellungen,GPOs46USB-GerteFestlegenvonGPOsfür37VerwendungmitView-Desktops61Vvdm_client.
                adm-DateizumFestlegenvonGPOs37Verbinden,USB-Gerte63,65ViewAgent,Installationsanforderungen15ViewClientAusführungvonderBefehlszeile49Befehlssyntax49InstallationaufeinemWindows-PCoder-Lap-top19Installationsübersicht19Konfigurationsdatei51Registrierungseinstellungen52starten19,55SystemanforderungenfürWindows8UnbeaufsichtigteInstallationaufeinemWind-ows-PCoder-Laptop23UnbeaufsichtigteInstallation,Eigenschaf-ten24unerwartetesBeenden73ViewClientinstallieren,Konfigurieren29ViewPortal,Browseranforderungen14View-Komponenten,BefehlszeilenoptionenfürdieunbeaufsichtigteInstallation25View-Verbindungsserver15virtuelleDrucker70virtuelleDruckfunktion61,70virtuelleProfile61vmware-view,BefehlKonfigurationsdatei51Syntax49VoIP(VoiceoverIP)12VoraussetzungenfürClientgerte15WWebbrowseranforderungen14Webcam66,67WechselnzwischenDesktops58Windows,InstallationvonViewClientauf8Windows-Computer,ViewClient-Installation19WyseMMR61ZZertifikate,IgnorierenvonProblemen34,35VerwendungvonVMwareViewHorizonClientfürWindows76VMware,Inc.

                chrome17为你推荐
                竞赛winrar5供应商搜狗浏览器2甘肃中盛招标」代理有限公司SCProute三星iphone仪器win7支持ipad支持ipad支持ipadipad如何上网iPad怎么上网?请㊣ 高手指点
                云服务器租用 美国虚拟主机推荐 顶级域名 域名管理 网址域☉名注册 个人注『册域名 我的世界服务器租用 免费vps 域名备案流程 如何注销域名备案 免费域名解析 smartvps sugarhosts 132邮箱 google镜像 主机评测 cve-2014-6271 精品网 163网 香港托管 更多
                赞助商